The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525254.4.peg.1302: Anaerococcus lactolyticus ATCC 51172

This feature in The SEED Viewer

NCBI Taxonomy Id: 525254

Current Assignment: ABC transporter ATP-binding protein
Translate Function Assignments



Context on contig NZ_GG666046 from base 409641 to 421421 (11781 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1297 409641 410150 510 +           Phage antirepressor protein  
1298 410143 411195 1053 + -8         hypothetical protein  
1299 411235 413049 1815 + 39         TrsK-like protein  
1300 413296 413823 528 + 246 5     RNA polymerase sigma-70 factor, ECF subfamily  
1301 413820 414608 789 + -4         hypothetical protein  
1302 414589 415476 888 + -20   3: 1 3 2   ABC transporter ATP-binding protein  
1303 415469 416662 1194 + -8         hypothetical protein  
1304 417086 417523 438 + 423         hypothetical protein  
1305 417703 418008 306 + 179         hypothetical protein  
1306 418415 418561 147 + 406         hypothetical protein  
1307 418621 418761 141 + 59         hypothetical protein  
1308 419275 419421 147 + 513         hypothetical protein  
1309 419744 419863 120 + 322         hypothetical protein  
1310 420312 421421 1110 + 448         Staphopain A precursor (EC 3.4.22.48)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
pantothenate_MCF_transporter Huang_Lili_user ABC transporter ATP-binding protein
YjeF_AMarbaix ABC transporter ATP-binding protein
YjeF_AMarbaix_bis ABC transporter ATP-binding protein


  Protein Sequence

>fig|525254.4.peg.1302 ABC transporter ATP-binding protein
MNLVLNKVKKSFGNMKAVDNVSIEMEEGLYGLLGSNGAGKTTLMRMLCTVLKPTEGSICY
DGMDIFKMDAQYRDIIGYLPQEFGFYPNLSVKKYLSYIASLKGLKNKVAERRIDILLETT
GMKEHSFKKMKELSGGMKRRVGIAQALLNDPKILILDEPTAGLDPIERIKCRNLLGELAK
GKIVLLSTHIVSDIEAIAKKVFVMKEGKIIKEGTVEELCSNIPCKVWLYYLNTDEAEGFI
SRFKSSISAINNNGKYTEVRILSENKPNDNARCVDATLEDLFYYYFGIEGGDKYD

MD5 = 9870e62606ade41a49a7a7e48ba7ba45


  DNA Sequence

>fig|525254.4.peg.1302 ABC transporter ATP-binding protein
atgaatttggttttgaataaagtaaaaaaaagttttggaaatatgaaggctgttgacaat
gtttcgattgaaatggaagaaggtctatatggattacttggttcaaatggtgcaggcaaa
actacgcttatgagaatgctatgtaccgttttgaagcctacagaaggttctatatgttat
gatggtatggatatatttaagatggatgctcaatatagggatattataggctatcttcca
caagaatttggattttatcctaatcttagcgtaaaaaagtacctttcctatattgcttcg
ttaaaaggtttaaagaataaagtggcagaaagacgtattgatattttactagaaacaaca
ggaatgaaggaacattcgtttaaaaaaatgaaagaactatccggaggaatgaagaggcgt
gtaggtattgctcaagcattattaaatgatccaaaaatacttatacttgatgaacctacg
gctggacttgatccaattgaaagaataaaatgtagaaatttattaggtgaacttgcaaaa
ggtaagattgtacttttatctacacacattgtttccgatatagaagctattgccaagaaa
gtatttgtcatgaaggaagggaaaattataaaagaaggtacagttgaagaattgtgttca
aacattccttgtaaggtttggctgtattatttaaatactgatgaagcagaaggatttatt
agcagatttaaaagttctatcagtgcgataaataataatgggaaatatacagaagtaaga
attttatcagaaaataaaccgaatgataatgctaggtgcgttgatgccacacttgaagat
ttattttactattactttgggatagaaggtggagataaatatgattaa


  DNA with Flanking Sequence

>fig|525254.4.peg.1302 ABC transporter ATP-binding protein
ttatgtacaaagaggattaagcataatagcctcattgtttgttatactcgtaattcctga
gttatggaggaatattgagaataaatcaatagagattgaggaaacttcaattttcaattt
acgaaagatatatgcagctaaacttatagcttttggttttattgatactactattttgac
actgttttgtatttatgctgtgcagatgcaagaaatcatgtttgcagatattttaaagca
atttatatttccaattatgattgcttcaatgatttgtatgaaggcattttccggaagaaa
atattttaaccaacttataacaatgattatatgtattgctgcaaatatggtttggatgat
gattgtattaaacgagtatatctatttaaaaataactccttttgtttgggtggtgatgtt
tagtacaagtattttattaacaatttattatattaaaaaagccttacacaacaacattag
acacttggaggtgaaaatcaatgaatttggttttgaataaagtaaaaaaaagttttggaa
atatgaaggctgttgacaatgtttcgattgaaatggaagaaggtctatatggattacttg
gttcaaatggtgcaggcaaaactacgcttatgagaatgctatgtaccgttttgaagccta
cagaaggttctatatgttatgatggtatggatatatttaagatggatgctcaatataggg
atattataggctatcttccacaagaatttggattttatcctaatcttagcgtaaaaaagt
acctttcctatattgcttcgttaaaaggtttaaagaataaagtggcagaaagacgtattg
atattttactagaaacaacaggaatgaaggaacattcgtttaaaaaaatgaaagaactat
ccggaggaatgaagaggcgtgtaggtattgctcaagcattattaaatgatccaaaaatac
ttatacttgatgaacctacggctggacttgatccaattgaaagaataaaatgtagaaatt
tattaggtgaacttgcaaaaggtaagattgtacttttatctacacacattgtttccgata
tagaagctattgccaagaaagtatttgtcatgaaggaagggaaaattataaaagaaggta
cagttgaagaattgtgttcaaacattccttgtaaggtttggctgtattatttaaatactg
atgaagcagaaggatttattagcagatttaaaagttctatcagtgcgataaataataatg
ggaaatatacagaagtaagaattttatcagaaaataaaccgaatgataatgctaggtgcg
ttgatgccacacttgaagatttattttactattactttgggatagaaggtggagataaat
atgattaaacatgaaattaatatagtatttagtaatcgtataaataggcttgtattacta
tttttattggtcgtggcagtagttttaagcatatttgctgtatggagtgtaagttatgta
gataaggatgggattacacataatggattatttgctgcaaggcaattaactgaagctaaa
gctgaatatgcagggaagttaaactctgatatttttgaagatatagtaaatacagataag
agaattaaaagtgaatatggaaacaaaatcccagagaacatatatgctgataatatgcaa
aaatatatggatataaaagattttatggttagcactatatcttatggaggggatatagac
tatacaagatttgatgcattagattcagatatggcaagaaatatgtatgctataagagat
gataatattgttcacttaatcaacgaatatggaactacagaggagaaaacagaatttttg
aagaaacaatattcaaagcttgttactc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0016887       F:ATPase activity
gb|EEI85544.1 Anaerococcus lactolyticus ATCC 51172     ABC superfamily ATP binding cassette transporter, ABC protein
gi|227235529 Anaerococcus lactolyticus ATCC 51172 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|227486481 Anaerococcus lactolyticus ATCC 51172 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
ref|ZP_03916797.1 Anaerococcus lactolyticus ATCC 51172 RefSeq   ABC superfamily ATP binding cassette transporter, ABC protein
tr|C2BHR4 Anaerococcus lactolyticus ATCC 51172 TrEMBL   ABC superfamily ATP binding cassette transporter, ABC protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|525254.4.peg.1300 RNA polymerase sigma-70 factor, ECF subfamily


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search