The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525254.4.peg.1301: Anaerococcus lactolyticus ATCC 51172

This feature in The SEED Viewer

NCBI Taxonomy Id: 525254

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG666046 from base 409641 to 419421 (9781 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1297 409641 410150 510 +           Phage antirepressor protein  
1298 410143 411195 1053 + -8         hypothetical protein  
1299 411235 413049 1815 + 39         TrsK-like protein  
1300 413296 413823 528 + 246         RNA polymerase sigma-70 factor, ECF subfamily  
1301 413820 414608 789 + -4         hypothetical protein  
1302 414589 415476 888 + -20     3: 1 3 2   ABC transporter ATP-binding protein  
1303 415469 416662 1194 + -8         hypothetical protein  
1304 417086 417523 438 + 423         hypothetical protein  
1305 417703 418008 306 + 179         hypothetical protein  
1306 418415 418561 147 + 406         hypothetical protein  
1307 418621 418761 141 + 59         hypothetical protein  
1308 419275 419421 147 + 513         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|525254.4.peg.1301 hypothetical protein
MKQMNFSEDRLEKILKNMNKQNEQKPSKEAIDSLVLKARELINSIDNESRIGFIEFIILQ
VKIMKKECWLAQAFLLFIAAKWLSISNGEAYVQRGLSIIASLFVILVIPELWRNIENKSI
EIEETSIFNLRKIYAAKLIAFGFIDTTILTLFCIYAVQMQEIMFADILKQFIFPIMIASM
ICMKAFSGRKYFNQLITMIICIAANMVWMMIVLNEYIYLKITPFVWVVMFSTSILLTIYY
IKKALHNNIRHLEVKINEFGFE

MD5 = f9f7171feaa75b499c9ef41f8c657123


  DNA Sequence

>fig|525254.4.peg.1301 hypothetical protein
atgaaacagatgaatttttctgaagatagactagaaaaaattctaaaaaatatgaataaa
caaaatgagcagaaaccgtctaaggaagcaatagatagtttagttctcaaagctagagaa
ttgatcaatagcatagataatgaaagtagaattggatttattgaatttattattttacaa
gtcaaaatcatgaaaaaagagtgttggcttgcacaagcatttttgctttttattgcagca
aaatggttatctatttcgaatggtgaagcttatgtacaaagaggattaagcataatagcc
tcattgtttgttatactcgtaattcctgagttatggaggaatattgagaataaatcaata
gagattgaggaaacttcaattttcaatttacgaaagatatatgcagctaaacttatagct
tttggttttattgatactactattttgacactgttttgtatttatgctgtgcagatgcaa
gaaatcatgtttgcagatattttaaagcaatttatatttccaattatgattgcttcaatg
atttgtatgaaggcattttccggaagaaaatattttaaccaacttataacaatgattata
tgtattgctgcaaatatggtttggatgatgattgtattaaacgagtatatctatttaaaa
ataactccttttgtttgggtggtgatgtttagtacaagtattttattaacaatttattat
attaaaaaagccttacacaacaacattagacacttggaggtgaaaatcaatgaatttggt
tttgaataa


  DNA with Flanking Sequence

>fig|525254.4.peg.1301 hypothetical protein
tgtcgcattagaaatggtgatgataaggctgcagaaattataattcgaaaatattatatg
aaagtctttgactactgcaagtatcattccgagaatatacatgcagccgaagatttaaca
caagaggtatttttgatttttttaaagaaaattgatcaatataaacataggggtaaactt
ttaaactatttatatacgattgctcgcaataagtgtattgatgagagaaaaaaagaaagt
aataaagatatttcaattgaatgtattgactatgaggtatcatcaagttttaatgaatcc
gaaagaacaatagaatctttatatgttagggaagcggttgaaaagctaccatcagatatt
agagagattataatcatgtattattttcttgatatgaaacagcgagaaattgctgatata
tgcaacatttcattagaacttgtaaaatacagattgaagaaaggtaaagaaatgataaaa
aagtatataggaggtgaaatatgaaacagatgaatttttctgaagatagactagaaaaaa
ttctaaaaaatatgaataaacaaaatgagcagaaaccgtctaaggaagcaatagatagtt
tagttctcaaagctagagaattgatcaatagcatagataatgaaagtagaattggattta
ttgaatttattattttacaagtcaaaatcatgaaaaaagagtgttggcttgcacaagcat
ttttgctttttattgcagcaaaatggttatctatttcgaatggtgaagcttatgtacaaa
gaggattaagcataatagcctcattgtttgttatactcgtaattcctgagttatggagga
atattgagaataaatcaatagagattgaggaaacttcaattttcaatttacgaaagatat
atgcagctaaacttatagcttttggttttattgatactactattttgacactgttttgta
tttatgctgtgcagatgcaagaaatcatgtttgcagatattttaaagcaatttatatttc
caattatgattgcttcaatgatttgtatgaaggcattttccggaagaaaatattttaacc
aacttataacaatgattatatgtattgctgcaaatatggtttggatgatgattgtattaa
acgagtatatctatttaaaaataactccttttgtttgggtggtgatgtttagtacaagta
ttttattaacaatttattatattaaaaaagccttacacaacaacattagacacttggagg
tgaaaatcaatgaatttggttttgaataaagtaaaaaaaagttttggaaatatgaaggct
gttgacaatgtttcgattgaaatggaagaaggtctatatggattacttggttcaaatggt
gcaggcaaaactacgcttatgagaatgctatgtaccgttttgaagcctacagaaggttct
atatgttatgatggtatggatatatttaagatggatgctcaatatagggatattataggc
tatcttccacaagaatttggattttatcctaatcttagcgtaaaaaagtacctttcctat
attgcttcgttaaaaggtttaaagaataaagtggcagaaagacgtattgatattttacta
gaaacaacaggaatgaaggaacattcgtttaaaaaaatgaaagaactatccggaggaatg
aagaggcgtgtaggtattgctcaagcattattaaatgatccaaaaatacttatacttgat
gaacctacggctggacttgatccaattgaaagaataaaatgtagaaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEI85543.1 Anaerococcus lactolyticus ATCC 51172     conserved hypothetical protein
gi|227235528 Anaerococcus lactolyticus ATCC 51172 NCBI   conserved hypothetical protein
gi|227486480 Anaerococcus lactolyticus ATCC 51172 NCBI   conserved hypothetical protein
ref|ZP_03916796.1 Anaerococcus lactolyticus ATCC 51172 RefSeq   conserved hypothetical protein
tr|C2BHR3 Anaerococcus lactolyticus ATCC 51172 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search