The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525254.4.peg.1297: Anaerococcus lactolyticus ATCC 51172

This feature in The SEED Viewer

NCBI Taxonomy Id: 525254

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_GG666046 from base 404519 to 415476 (10958 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1295 404519 404992 474 +       1: 4   Transcription elongation factor GreA  
1296 405002 406915 1914 + 9     2: 6 1   Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)  
1297 409641 410150 510 + 2725         Phage antirepressor protein  
1298 410143 411195 1053 + -8         hypothetical protein  
1299 411235 413049 1815 + 39         TrsK-like protein  
1300 413296 413823 528 + 246         RNA polymerase sigma-70 factor, ECF subfamily  
1301 413820 414608 789 + -4         hypothetical protein  
1302 414589 415476 888 + -20     3: 5 3 2   ABC transporter ATP-binding protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|525254.4.peg.1297 Phage antirepressor protein
MYSLILSSKLPQAKIFKAWVTREVLPSIRKNGGYIAGQEKKTNEELLADAILVANRIIAK
REEEIEVLRPKADYYDKLVDYNLLTNFRNTAKELGIPQNQFISFLMDKGLIYRDKKKKLL
PYADKNKGYFEVKEWVDPLGTLVGIQTFITPKGRHYLLILLDSEGFYDE

MD5 = faaf5f46ff1221a460346a72115fb198


  DNA Sequence

>fig|525254.4.peg.1297 Phage antirepressor protein
ttgtattcacttatcctctcatcaaaactaccacaagcaaaaatattcaaagcttgggta
actagagaagttttaccgagcattagaaaaaatggaggatatatagctggtcaagaaaag
aaaactaacgaagagctacttgcagatgcaattctagtagccaatagaattattgccaaa
agagaagaagaaattgaagtattaagaccaaaggcagactattatgacaaattagtagat
tataatctacttacaaactttagaaacactgctaaagagttaggaataccacaaaatcaa
tttataagttttctaatggataagggattaatttatagagataagaaaaagaaacttcta
ccttatgcagataagaacaagggatattttgaagtaaaagaatgggttgaccctctaggt
acacttgtaggcatacaaacatttataacaccaaagggaagacactacctactaatttta
ttagatagtgaaggtttctacgatgaataa


  DNA with Flanking Sequence

>fig|525254.4.peg.1297 Phage antirepressor protein
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnttatgttaatccaagaaaagctatttatgaccatg
tagatgaagaagataagggtgtaacgaaatggaacacccctggaggaatacagaatattt
caataattaatgagtcaggattgtattcacttatcctctcatcaaaactaccacaagcaa
aaatattcaaagcttgggtaactagagaagttttaccgagcattagaaaaaatggaggat
atatagctggtcaagaaaagaaaactaacgaagagctacttgcagatgcaattctagtag
ccaatagaattattgccaaaagagaagaagaaattgaagtattaagaccaaaggcagact
attatgacaaattagtagattataatctacttacaaactttagaaacactgctaaagagt
taggaataccacaaaatcaatttataagttttctaatggataagggattaatttatagag
ataagaaaaagaaacttctaccttatgcagataagaacaagggatattttgaagtaaaag
aatgggttgaccctctaggtacacttgtaggcatacaaacatttataacaccaaagggaa
gacactacctactaattttattagatagtgaaggtttctacgatgaataaggtattagaa
gccattctttctgatattaaaaacctaattaaaatagacaacccaaagaaatttatatta
gcaaacattccttatctatcatttttttacattggaaatatcttttctaagcacattaat
tcttatgttggaggagatattattgatagattaatggtgggaatttctgatataggaact
ttatcctatataccaagtattaatccaagggacttgttagtaggtatttcagttgctggt
cttgttaagctaattgtttatagcaaagggaaaaataaaaagaaatataggcaaggcaag
gagtatggatctgcaagatggggagaaagtaaggatattgctccatacattgaccctaag
tttgaaaacaatgttctcataactaatactgaaagacttacaatgaactcaagacctaaa
aatcctaaatacgctaggaataaaaatgtattagtaataggtggttctggatcaggtaaa
acgagatttt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search