The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525254.4.peg.1296: Anaerococcus lactolyticus ATCC 51172

This feature in The SEED Viewer

NCBI Taxonomy Id: 525254

Current Assignment: Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
Translate Function Assignments



Context on contig NZ_GG666046 from base 399745 to 413049 (13305 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1289 399745 400278 534 +           hypothetical protein  
1290 400262 401626 1365 + -17     5: 22 12 7 14 1   tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)  
1291 401616 402185 570 + -11     3: 8 5 1   Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)  
1292 402229 402720 492 + 43         hypothetical protein  
1293 402783 403574 792 + 62 10 11: 3 20 19 11 4 2 15 21 13 17 16   Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)  
1294 403552 404550 999 + -23 24 1: 6   tRNA dihydrouridine synthase B (EC 1.-.-.-)  
1295 404519 404992 474 + -32 17 1: 9   Transcription elongation factor GreA  
1296 405002 406915 1914 + 9   2: 10 18   Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)  
1297 409641 410150 510 + 2725         Phage antirepressor protein  
1298 410143 411195 1053 + -8         hypothetical protein  
1299 411235 413049 1815 + 39         TrsK-like protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
tRNA_aminoacylation,_Lys gjo Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
tRNA_synthetase_relationships howard.969 Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)


  Protein Sequence

>fig|525254.4.peg.1296 Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
MADNIQDLNEMLKIRREKLHELKEEGKDPHRIVNFKNRISSKEIKDNFEKYEDQTVRVAG
RILAKRGHGNMSFMDVQDDLGQIQVVNRKNVIGDDFKYIKKYDIGDIIGVEGKVFKTNQG
EISIEVAKSDLLTKALQMLPEKWHGLKDPDLRYRQRYIDLIVNPEVKEVFVQRSRIISAI
REFLDGRGFLEVETPILNTIAGGATARPFITHHNTLDIDMYLRIANELYLKRLIVGGFDR
VYEIGRMFRNEGMDATHNPEYTAMELYQAYGDYEDMMEITENMVEHVAKKVKGTTLVEFD
GHEIELKAPWKRIPMIEAVKEYSGVDFNEIKTDEEAKAIAKEKGVEVKETRGEIIAEFFD
EFVEDKLIQPTFITDYPVEISPLAKRKNDDRSLTYRFEAFVSGAEIGNAFSELNDAEDQR
ARFEDQVRKREAGDDEAQMMDYDFVNALEVGLPPTGGLGIGIDRLIMILTGQHSIRDVLL
FPTMKPIGLEKAENGGLSKETYETYDKLTTEEIDLSKVKVEPLFEDMVDFETFSKSDFRV
VKVKNCEEVPKSKKLLKFTLDDGSEKERVILSGIKEYYSAESLIGKTLLAICNLPPRKMM
GIDSEGMIISAICEYDGEEKLNLIMLDDNIPAGSKLY

MD5 = c6cbf44bc2c62f7518e7e6b68a66ef43


  DNA Sequence

>fig|525254.4.peg.1296 Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
atggctgataacattcaagatttaaatgaaatgcttaagattagaagagaaaaacttcat
gaacttaaggaagagggcaaggacccacaccgcatagttaattttaaaaataggataagc
tcaaaagaaatcaaggataactttgagaagtatgaagatcaaactgtaagggtagctgga
agaatccttgcaaaaagaggtcatggtaacatgagctttatggatgttcaagatgacctt
ggtcaaatccaagttgttaaccgtaaaaatgttatcggcgatgactttaaatatatcaaa
aaatacgatatcggtgatatcatcggtgttgaaggcaaggtatttaaaactaaccaaggt
gaaatatcaatagaagtagcaaaaagcgaccttttaaccaaggctctccaaatgcttcct
gaaaaatggcacggcctaaaggacccagaccttagatatagacaaagatatatagactta
atagtaaatcctgaagtaaaagaagtttttgttcaaagatcaagaataatttcagcaatc
agagaatttttggacggtaggggattcttagaagtagaaactcctatcctcaatacaatc
gcaggtggagctactgctcgtccatttattacccaccacaacactctagatatcgatatg
tacctaaggattgccaacgaactttacctaaaaaggctaatcgtaggtggttttgatagg
gtatatgaaatcggtaggatgtttagaaacgaaggaatggacgcaacccacaacccagaa
tacaccgccatggaattataccaagcctacggcgactatgaagacatgatggaaatcact
gaaaacatggtagagcacgttgcaaaaaaagtaaagggcacaacccttgtagaatttgac
ggccatgaaatagagcttaaggctccatggaagagaattccaatgatagaagctgtaaaa
gaatattctggcgtagactttaacgaaattaaaactgacgaagaagccaaagccattgcc
aaggaaaaaggtgtggaagtaaaggaaacaagaggcgaaattattgcagaattctttgat
gaatttgttgaagataagctaatccaaccaaccttcatcacagactatcccgtagaaatc
tcaccacttgccaagagaaagaacgacgataggtcactaacctataggtttgaagccttt
gtttctggagcagaaatcggcaacgccttctcagaattaaacgatgcagaagaccaaaga
gcaaggtttgaagaccaagttagaaaaagagaagcaggcgatgatgaagcccaaatgatg
gactatgactttgtaaatgccctagaagtaggtctacctccaacaggtggacttggaatt
ggtatcgataggctaatcatgattttaacaggtcaacattcaatcagggacgtacttcta
ttcccaacaatgaagccaataggcttagaaaaggcagaaaatgggggtttgtcaaaagaa
acttacgaaacttacgacaaacttacgacagaagaaattgacctttcaaaagtgaaagtt
gaaccattatttgaagatatggtagactttgaaactttctcaaaatctgattttagagtt
gtaaaggttaaaaactgcgaagaagttcctaagtcaaaaaaacttttgaaatttacatta
gatgatggttctgaaaaagaaagagttattttatctggtattaaggaatattacagcgca
gagagcttaattggaaagacactacttgcaatttgtaatcttcctcctcgtaagatgatg
ggaatcgactcagaaggtatgattatatctgcaatttgtgagtatgacggtgaagaaaaa
cttaacttaataatgctggatgataatattccagcaggatcaaaattatattaa


  DNA with Flanking Sequence

>fig|525254.4.peg.1296 Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)
aattttaggtgattataatgacagagaagaaagaagtaatattaactaaggaaaaattag
aaaaattagaggacgaattagagtatttaaaaacgaaaaaacgtcctgaaatggcagaaa
aaatcaaaatagcaagaagcttcggtgacctttcagaaaatgctgattacgatgaagcaa
agaatgaacaaggtgaagtagaatcaagaatcatgaagatagaagacatgattagaaatg
ccaagactatcgaagttgatgaaaattctgacactgttggtgttggcaatactgtttgtc
tttacgatgaagaatttgaagaagatgtagaatataaaatcgtaggaacagctgaatcaa
acccacttgaagggtatatttctaatgagtcaccagttggtgaagctatcattggtcata
agattaatgatagggtagaagtagaaactccaaatggcaagatgtattttgtaattaaga
atattaagtaaggagaaaaaatggctgataacattcaagatttaaatgaaatgcttaaga
ttagaagagaaaaacttcatgaacttaaggaagagggcaaggacccacaccgcatagtta
attttaaaaataggataagctcaaaagaaatcaaggataactttgagaagtatgaagatc
aaactgtaagggtagctggaagaatccttgcaaaaagaggtcatggtaacatgagcttta
tggatgttcaagatgaccttggtcaaatccaagttgttaaccgtaaaaatgttatcggcg
atgactttaaatatatcaaaaaatacgatatcggtgatatcatcggtgttgaaggcaagg
tatttaaaactaaccaaggtgaaatatcaatagaagtagcaaaaagcgaccttttaacca
aggctctccaaatgcttcctgaaaaatggcacggcctaaaggacccagaccttagatata
gacaaagatatatagacttaatagtaaatcctgaagtaaaagaagtttttgttcaaagat
caagaataatttcagcaatcagagaatttttggacggtaggggattcttagaagtagaaa
ctcctatcctcaatacaatcgcaggtggagctactgctcgtccatttattacccaccaca
acactctagatatcgatatgtacctaaggattgccaacgaactttacctaaaaaggctaa
tcgtaggtggttttgatagggtatatgaaatcggtaggatgtttagaaacgaaggaatgg
acgcaacccacaacccagaatacaccgccatggaattataccaagcctacggcgactatg
aagacatgatggaaatcactgaaaacatggtagagcacgttgcaaaaaaagtaaagggca
caacccttgtagaatttgacggccatgaaatagagcttaaggctccatggaagagaattc
caatgatagaagctgtaaaagaatattctggcgtagactttaacgaaattaaaactgacg
aagaagccaaagccattgccaaggaaaaaggtgtggaagtaaaggaaacaagaggcgaaa
ttattgcagaattctttgatgaatttgttgaagataagctaatccaaccaaccttcatca
cagactatcccgtagaaatctcaccacttgccaagagaaagaacgacgataggtcactaa
cctataggtttgaagcctttgtttctggagcagaaatcggcaacgccttctcagaattaa
acgatgcagaagaccaaagagcaaggtttgaagaccaagttagaaaaagagaagcaggcg
atgatgaagcccaaatgatggactatgactttgtaaatgccctagaagtaggtctacctc
caacaggtggacttggaattggtatcgataggctaatcatgattttaacaggtcaacatt
caatcagggacgtacttctattcccaacaatgaagccaataggcttagaaaaggcagaaa
atgggggtttgtcaaaagaaacttacgaaacttacgacaaacttacgacagaagaaattg
acctttcaaaagtgaaagttgaaccattatttgaagatatggtagactttgaaactttct
caaaatctgattttagagttgtaaaggttaaaaactgcgaagaagttcctaagtcaaaaa
aacttttgaaatttacattagatgatggttctgaaaaagaaagagttattttatctggta
ttaaggaatattacagcgcagagagcttaattggaaagacactacttgcaatttgtaatc
ttcctcctcgtaagatgatgggaatcgactcagaaggtatgattatatctgcaatttgtg
agtatgacggtgaagaaaaacttaacttaataatgctggatgataatattccagcaggat
caaaattatattaaaggacacgctaattatgaaactggggtttgttatgaatcccagttt
aatttttaggagtatgtatgagatggataattagaataattttattaccgataagattag
tgttgagtttgctcatagcttttttaaccttcatattaagtttgagtactgcgttgttaa
gcgtagtttctactttgatttttataattggaatagctagcatttttcaaggagacaagc
aaattgtaattgaagcactaatattagcatttttatttagtccatttggattacctaaat
taggtatatatgttattggattattagaattattaatctatacaataaaatcaatttgaa
gaaaaataaatataagacaaccgtagacgatagaaagcaataattctgtcgtcttttttt
attttaaagagaggaggtaggaatgaattttgattatttttataataggcaatctgaaat
gtataacttcattaggttacctatggtattaatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000049       F:tRNA binding
GO:0004824       F:lysine-tRNA ligase activity
GO:0005524       F:ATP binding
GO:0005737       C:cytoplasm
GO:0006430       P:lysyl-tRNA aminoacylation
gb|EEI85669.1 Anaerococcus lactolyticus ATCC 51172     possible lysine--tRNA ligase
gi|227235654 Anaerococcus lactolyticus ATCC 51172 NCBI   possible lysine--tRNA ligase
gi|227486473 Anaerococcus lactolyticus ATCC 51172 NCBI   possible lysine--tRNA ligase
ref|ZP_03916789.1 Anaerococcus lactolyticus ATCC 51172 RefSeq   possible lysine--tRNA ligase
tr|C2BHQ6 Anaerococcus lactolyticus ATCC 51172 TrEMBL   Lysyl-tRNA synthetase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|525254.4.peg.1293 Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)
24 fig|525254.4.peg.1294 tRNA dihydrouridine synthase B (EC 1.-.-.-)
17 fig|525254.4.peg.1295 Transcription elongation factor GreA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search