The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|519441.6.peg.906: Streptobacillus moniliformis DSM 12112

This feature in The SEED Viewer

NCBI Taxonomy Id: 519441

Current Assignment: kilA protein, putative phage-related DNA binding protein
Translate Function Assignments



Context on contig NC_013515 from base 985305 to 996659 (11355 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
899 986153 985305 849 -           Conjugative transfer protein TrbG locus|Smon_0896, protein_id|YP_003306240.1, gi|269123663, InterPro:IPR010258, geneID|8600620
900 986654 986169 486 - 15     1: 1   hypothetical protein locus|Smon_0897, protein_id|YP_003306241.1, gi|269123664, geneID|8600621
901 987360 986656 705 - 1         Conjugative transfer protein TrbF locus|Smon_0898, protein_id|YP_003306242.1, gi|269123665, geneID|8600622
902 987733 987347 387 - -14         Conjugative transfer protein TrbF locus|Smon_0899, protein_id|YP_003306243.1, gi|269123666, geneID|8600623
903 990052 988538 1515 - 804     1: 1   hypothetical protein locus|Smon_0900, protein_id|YP_003306244.1, gi|269123667, InterPro:IPR005053, geneID|8600624
904 990527 990162 366 - 109     1: 1   hypothetical protein  
905 990898 990599 300 - 71     1: 1   hypothetical protein  
906 991595 990915 681 - 16         kilA protein, putative phage-related DNA binding protein locus|Smon_0902, protein_id|YP_003306245.1, gi|269123668, InterPro:IPR003497, geneID|8600626
907 991980 991597 384 - 1     1: 1   hypothetical protein locus|Smon_0903, protein_id|YP_003306246.1, gi|269123669, geneID|8600627
908 992186 992001 186 - 20     1: 1   hypothetical protein locus|Smon_0904, protein_id|YP_003306247.1, gi|269123670, geneID|8600628
909 992409 992176 234 - -11     1: 1   hypothetical protein locus|Smon_0905, protein_id|YP_003306248.1, gi|269123671, geneID|8600629
910 993039 992689 351 - 279         Replication initiation protein A # truncated locus|Smon_0907, protein_id|YP_003306250.1, gi|269123673, InterPro:IPR010724, geneID|8600631
911 993368 993210 159 - 170     1: 1   hypothetical protein locus|Smon_0908, protein_id|YP_003306251.1, gi|269123674, geneID|8600632
912 993713 993865 153 + 344     1: 1   hypothetical protein locus|Smon_0909, protein_id|YP_003306252.1, gi|269123675, InterPro:IPR001387, geneID|8600633
913 994423 994815 393 + 557         Transcriptional regulator, Xre family locus|Smon_0910, protein_id|YP_003306253.1, gi|269123676, InterPro:IPR001387, geneID|8600634
914 995101 996162 1062 + 285         DNA integration/recombination/inversion protein locus|Smon_0912, protein_id|YP_003306255.1, gi|269123678, InterPro:IPR002104, geneID|8600636
915 996659 996309 351 - 146     3: 2 4 3   LSU ribosomal protein L19p locus|Smon_0913, protein_id|YP_003306256.1, gi|269123679, InterPro:IPR001857, geneID|8600637

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|519441.6.peg.906 kilA protein, putative phage-related DNA binding protein
MEILDRKEILGVELVIFGSEVSPRFNANEIARIIENSNVSQMIKEVDEDEKELVLVTRED
GRTHKQWYLTEDGLYEVLFASRKPIAKKFKKQVKEILKSIRQKGGYIVVKKEDNEATIKS
RIENLMKETEKKLRILENKINGYEIFFDEGKEYIGISFIAQKYEMKVDELIKILTEKRFL
YKKGKVLYLYRKHRYKNYGKYFKINKKNIFKFSLKGEAFISSLLNL

MD5 = 9f0c12dd04e1ee980ccb785109e78bba


  DNA Sequence

>fig|519441.6.peg.906 kilA protein, putative phage-related DNA binding protein
atggaaattttagatagaaaagagattctgggagtagaattggtaatatttggttctgaa
gtatctccaagatttaatgctaatgaaatagcaagaataattgaaaattcaaatgtatct
caaatgattaaagaagttgatgaagatgaaaaagaattagtattagtaactcgtgaagat
ggtagaactcataaacaatggtatttgaccgaggatggtctatatgaagtcttatttgca
agtagaaagcctatagcaaagaaatttaaaaagcaagttaaagaaatacttaaatcgata
agacaaaaaggtggatacatcgtagttaaaaaagaagacaatgaagctacaataaaatca
agaatagaaaatttaatgaaagaaacagagaaaaaattaagaattttagaaaataaaata
aatggatatgaaatattttttgatgaagggaaagaatatattggtattagttttattgca
caaaaatatgaaatgaaagtagatgaattaattaaaattcttacagaaaaaagattttta
tataaaaaaggaaaagtactttatttatatagaaaacatagatataaaaattatggtaaa
tattttaaaataaataagaaaaatatatttaaattcagtctaaaaggagaagcatttatt
tcaagtttattgaatttataa


  DNA with Flanking Sequence

>fig|519441.6.peg.906 kilA protein, putative phage-related DNA binding protein
taaaaattaaaaaaaataaagaaagagtagtttatttaatagaccaattaggaatgaaaa
aatatattttagaaagaaaagaatataaatgttagtaaagtgaaaggaaatcagaatgaa
ggaattttatttgaaaaaaaataataataatgaaattttatttttttatagatatagatt
taaagattctatctctaaagaagaatggattaaaagtattaatgaaaataaaacacttaa
taaaaaagattctcaaaaaacttttaaagaattattattatttttgaatattaaaaataa
aataatacataaacttgatgatgtagaaattactgtatggaaaggtaatgaatataagat
cacaagaataaaaatgaaaaatgataagaagtcaatgaatgatatgaaattttctatatc
agatgacaactatatttgcacggaaaatataatatatatcataaataaaaataataatat
aaatgaaaggttactataatatggaaattttagatagaaaagagattctgggagtagaat
tggtaatatttggttctgaagtatctccaagatttaatgctaatgaaatagcaagaataa
ttgaaaattcaaatgtatctcaaatgattaaagaagttgatgaagatgaaaaagaattag
tattagtaactcgtgaagatggtagaactcataaacaatggtatttgaccgaggatggtc
tatatgaagtcttatttgcaagtagaaagcctatagcaaagaaatttaaaaagcaagtta
aagaaatacttaaatcgataagacaaaaaggtggatacatcgtagttaaaaaagaagaca
atgaagctacaataaaatcaagaatagaaaatttaatgaaagaaacagagaaaaaattaa
gaattttagaaaataaaataaatggatatgaaatattttttgatgaagggaaagaatata
ttggtattagttttattgcacaaaaatatgaaatgaaagtagatgaattaattaaaattc
ttacagaaaaaagatttttatataaaaaaggaaaagtactttatttatatagaaaacata
gatataaaaattatggtaaatattttaaaataaataagaaaaatatatttaaattcagtc
taaaaggagaagcatttatttcaagtttattgaatttataatattgaggtgattaaaatg
gctttatcttatagttttcatatttcaaatggtaagagtgcaattaataattctaaaaac
ttaatcagagcattaaaaaataatttaagagcatataattctaataattttgacaaatca
attaatgatattttgattggagctaataatacaactggagcttttcaagattttaaagaa
ttatataaaactgaatttactcattctataaacgaatacaataaaaaacaaatcagagaa
gatagaaaaataaaaaattattttgaaaaatttctgatgataaaaaaactgagttagcaa
cagaaattattatccaggttggagatatggacttttggaaaaataaaaatatcaaggata
aaaaattaatgaatgatatatttaaacagcaactagaaaaattggttgaaatatgtccga
attttaaaattgtcagtgcagtaatatgttatgataaaaatagtcctcatatgaaagtaa
t


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search