The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|515621.3.peg.1992: Clostridium botulinum Ba4 str. 657

This feature in The SEED Viewer

NCBI Taxonomy Id: 515621

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_012658 from base 1807169 to 1818123 (10955 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1985 1807169 1808530 1362 +           Conserved membrane protein locus|CLJ_B1762, protein_id|YP_002862546.1, gi|237794994, geneID|7877486
1986 1808699 1808917 219 + 168         FIG00514653: hypothetical protein locus|CLJ_B1763, protein_id|YP_002862547.1, gi|237794995, geneID|7878946
1987 1810578 1809505 1074 - 587         hypothetical protein locus|CLJ_B1764, protein_id|YP_002862548.1, gi|237794996, geneID|7878739
1988 1811086 1810640 447 - 61         Phage repressor protein locus|CLJ_B1765, protein_id|YP_002862549.1, gi|237794997, geneID|7880016
1989 1811530 1811105 426 - 18         transcriptional regulator, Cro/CI family locus|CLJ_B1766, protein_id|YP_002862550.1, gi|237794998, geneID|7879011
1990 1811758 1811961 204 + 227         Helix-turn-helix motif locus|CLJ_B1767, protein_id|YP_002862551.1, gi|237794999, geneID|7879805
1991 1811978 1812277 300 + 16         hypothetical protein locus|CLJ_B1768, protein_id|YP_002862552.1, gi|237795000, geneID|7878108
1992 1812298 1813038 741 + 20       Phage antirepressor protein locus|CLJ_B1769, protein_id|YP_002862553.1, gi|237795001, geneID|7877725
1993 1813050 1813403 354 + 11         FIG00533536: hypothetical protein locus|CLJ_B1770, protein_id|YP_002862554.1, gi|237795002, geneID|7877529
1994 1813396 1813563 168 + -8         FIG00514230: hypothetical protein locus|CLJ_B1771, protein_id|YP_002862555.1, gi|237795003, geneID|7877816
1995 1813601 1813813 213 + 37         phage protein  
1996 1814003 1814314 312 + 189         FIG00516434: hypothetical protein locus|CLJ_B1774, protein_id|YP_002862558.1, gi|237795006, geneID|7881063
1997 1814314 1814532 219 + -1         FIG00520334: hypothetical protein locus|CLJ_B1775, protein_id|YP_002862559.1, gi|237795007, geneID|7877808
1998 1814534 1814668 135 + 1         FIG00526160: hypothetical protein locus|CLJ_B1776, protein_id|YP_002862560.1, gi|237795008, geneID|7879492
1999 1814665 1815162 498 + -4         Phage phi 11 orf61 protein homolog locus|CLJ_B1777, protein_id|YP_002862561.1, gi|237795009, geneID|7880981
2000 1815162 1815710 549 + -1         FIG00523119: hypothetical protein locus|CLJ_B1778, protein_id|YP_002862562.1, gi|237795010, geneID|7880364
2001 1815712 1815996 285 + 1         FIG00530321: hypothetical protein locus|CLJ_B1779, protein_id|YP_002862563.1, gi|237795011, geneID|7880796
2002 1816007 1816900 894 + 10 4     Phage replication initiation locus|CLJ_B1780, protein_id|YP_002862564.1, gi|237795012, geneID|7879479
2003 1817241 1817600 360 + 340     1: 1   DNA replication protein DnaC locus|CLJ_B1781, protein_id|YP_002862565.1, gi|237795013, geneID|7878707
2004 1817614 1817808 195 + 13         phage protein locus|CLJ_B1782, protein_id|YP_002862566.1, gi|237795014, geneID|7880896
2005 1817821 1818123 303 + 12         hypothetical protein locus|CLJ_B1783, protein_id|YP_002862567.1, gi|237795015, geneID|7878941

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|515621.3.peg.1992 Phage antirepressor protein
MNNLQIFNNQEFGLVRTIQKENAIWFVGKDVAKCLGYERPTKAIQDRVDNEDKDEVPIQD
SIGRNQNTPIINESGLYSLVLSSKLSTAKKFKRWVTSEVLPQIRQTGGYIPQNENETEED
ILAKAILIAQKTIEKKNRIIEEQKPLVSFANKVATSQNSLLVREVAKLASKEGINIGEKR
LWNKLREWGLIFKNTTEPKQYGIDRGYFEVVEGTRENKTGTFIYKTTRVTGKGQVYIISR
LEKELA

MD5 = abd2022a5310f0c68eb20241d818c6c3


  DNA Sequence

>fig|515621.3.peg.1992 Phage antirepressor protein
atgaataacttacaaattttcaataatcaagagtttggattagtaagaacaatacaaaaa
gaaaatgcaatttggtttgtaggaaaagatgttgctaaatgtttaggatatgaaagacca
acaaaagcaatacaagatcgagtagataatgaggataaagatgaagtcccaattcaggat
tccataggtcgaaaccaaaatacaccaataataaatgaaagtggactttacagtttagta
ttaagttctaaactatcaacagctaagaaatttaaaagatgggttacttctgaggtacta
ccacaaataagacaaacaggcgggtatattccacagaatgagaatgaaacagaagaagac
atactagccaaggctatattaatagcacagaagaccatagaaaagaaaaacagaataata
gaagaacaaaaaccattagttagtttcgctaataaggtagcaacatcacaaaatagttta
cttgttagagaagttgcaaagttagctagtaaagaaggaataaacataggagaaaaaaga
ctatggaacaagttaagagaatggggactaatatttaaaaacactacagagccaaagcaa
tacggaatagacagaggatattttgaggttgtagaaggtactagagaaaataaaacagga
acatttatctacaaaacaacacgtgttactggcaagggtcaagtttatataatatcaaga
ttagaaaaagaattagcatag


  DNA with Flanking Sequence

>fig|515621.3.peg.1992 Phage antirepressor protein
gtttagatactaacgaggctgttgaaatgctaggtataagcaaaagtactttctataaat
tagaacaaggacattcaactccaagtgcaaagctgattagtaaaattgctaaagtttatg
aatgtacaatagatgagatattcaaagatttaaaaattaattagaaggggaatgaattaa
atggagccgacagtgttaacacctaaacaattagctgaaagatggcaaacatgtttaaca
aaaatttatgaagataataatgctggtaaattacctcatttaaaaacaaataaaaataga
tttcctttgatagcaatagaagaaatggaaaatgagcctttatttaataagtatgatatt
aaaactcctagggaaaggagtttagaaaaagaatcagaagaatggaaacgcaaatatgaa
acattaaaaaattgtataaataatgcactaccagaattgcttaaaacaatgaatttataa
attttataggggatgattaaatgaataacttacaaattttcaataatcaagagtttggat
tagtaagaacaatacaaaaagaaaatgcaatttggtttgtaggaaaagatgttgctaaat
gtttaggatatgaaagaccaacaaaagcaatacaagatcgagtagataatgaggataaag
atgaagtcccaattcaggattccataggtcgaaaccaaaatacaccaataataaatgaaa
gtggactttacagtttagtattaagttctaaactatcaacagctaagaaatttaaaagat
gggttacttctgaggtactaccacaaataagacaaacaggcgggtatattccacagaatg
agaatgaaacagaagaagacatactagccaaggctatattaatagcacagaagaccatag
aaaagaaaaacagaataatagaagaacaaaaaccattagttagtttcgctaataaggtag
caacatcacaaaatagtttacttgttagagaagttgcaaagttagctagtaaagaaggaa
taaacataggagaaaaaagactatggaacaagttaagagaatggggactaatatttaaaa
acactacagagccaaagcaatacggaatagacagaggatattttgaggttgtagaaggta
ctagagaaaataaaacaggaacatttatctacaaaacaacacgtgttactggcaagggtc
aagtttatataatatcaagattagaaaaagaattagcatagggggtaattttatgaataa
agagcagattgtaaaagaaaaaatagcatctcttttcagaaagcataatatggaaggttc
aattactcaactgtttgtgtgtagatattttgatactaaggatattgaagatttaagagt
attagaacgagcaaaattaaatccgcaattaaaaatggaattaactaatttactaagaag
ttattttaactcaactaataaaatgacaccatatgaacaacttataaaacaaatagaaga
aagctttaactacagtaatacagatgcagaggagtacgctaaaaagctaaaaaacttgtc
tttagtagcattagaagaaatagaaagagaatttaaaaatgcttagaataggtgaagtta
tattagctatatacagcttagtaatacttttagcttttataggtgtagatatcaaacaac
taaaaaagattaaggacaatggatggcttacagtaatatttatacctataataatattcc
t


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|ACQ52645.1 Clostridium botulinum Ba4 str. 657     antirepressor, phage associated
gi|229261612 Clostridium botulinum Ba4 str. 657 NCBI   antirepressor, phage associated
gi|237795001 Clostridium botulinum Ba4 str. 657 NCBI   antirepressor, phage associated
kegg|cbi:CLJ_B1769 Clostridium botulinum Ba4 657 KEGG   antirepressor, phage associated
ref|YP_002862553.1 Clostridium botulinum Ba4 str. 657 RefSeq   antirepressor, phage associated
tr|C3KW65 Clostridium botulinum (strain 657 / Type Ba4) TrEMBL   Antirepressor, phage associated


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|515621.3.peg.2002 Phage replication initiation


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search