The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|500635.8.peg.80: Mitsuokella multacida DSM 20544

This feature in The SEED Viewer

NCBI Taxonomy Id: 500635

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_GG697141 from base 73645 to 83630 (9986 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
73 73645 75147 1503 +       6: 3 7 2 6 8 4   Anthranilate synthase, aminase component (EC 4.1.3.27)  
74 76341 75238 1104 - 90     1: 5   Site-specific tyrosine recombinase XerC  
75 76845 76720 126 - 378     1: 1   hypothetical protein  
76 77215 77820 606 + 369     1: 1   hypothetical protein  
77 78025 77906 120 - 85     1: 1   hypothetical protein  
78 78323 78439 117 + 297     1: 1   hypothetical protein  
79 78436 78600 165 + -4     1: 1   hypothetical protein  
80 79357 80049 693 + 756         Phage antirepressor protein  
81 80225 80338 114 + 175     1: 1   hypothetical protein  
82 81377 81616 240 + 1038     1: 1   hypothetical protein  
83 81609 83630 2022 + -8         Phage primase / Phage helicase  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|500635.8.peg.80 Phage antirepressor protein
MAEMIGKTHAHLCRDIDGYIAVMSQNPKLDSDKFFIKQTYTAGTGKQYKRYDITKMGCEM
VANKLTGQKGIMFTAKYVEIFNKMAEQIIEERTDSYMITDPVKRAKKWIEEETERQKLRA
ENKEMLPKAQFYDTVANTESLFSMADVAKTLDMGIGRNKLFAFLRNKGILDKDNHPYQKY
VDAGYLRLVEDHCKAGDNDVVYKCTYVKQKGIDYIRKILLKERELNEIVE

MD5 = 6d87ec9b43ed000d72f1a5f9849d9196


  DNA Sequence

>fig|500635.8.peg.80 Phage antirepressor protein
gtggcagagatgattggtaaaacacatgcacatctttgccgtgatattgatggatacatc
gccgtcatgagtcaaaatccaaaattggattctgataaattcttcatcaagcagacctat
acggcaggcacaggcaagcagtacaagcgttacgacattaccaagatgggatgcgagatg
gttgccaataaactcacaggacagaagggtatcatgtttacggcaaagtacgtagaaatc
ttcaataagatggcagagcaaatcattgaggagcgaacggactcctatatgattaccgat
cctgtaaagcgtgccaagaaatggattgaagaggagacggagcgccagaagctccgcgct
gagaataaggagatgctgccgaaagcacagttctatgacacggttgctaatacagagtcc
ttgttctccatggctgatgttgccaaaacattagatatgggcattggacgcaacaagctc
tttgcatttctccgtaacaagggtatccttgataaggacaatcacccatatcagaaatat
gtcgatgcaggatacttgagactcgttgaggatcattgcaaggcaggggataacgacgtt
gtatacaaatgtacctatgtcaaacagaagggcattgattatatccgtaagattctcttg
aaggagcgtgaactcaatgaaatcgtggagtga


  DNA with Flanking Sequence

>fig|500635.8.peg.80 Phage antirepressor protein
ttctgggatgaagcgcaaggaagtcgctgagaaattagggattaccatgcaggcttatac
gtgttatgaatatggcagacgagagcctagactcagtaacctcattaaattatccaaaat
cttcgatataccagttgatgtgttatgttcgccttatcccgtagacatgacaatcgacag
ttgctcggatttcatcaattcgattgacggttgcggcatcgagagaatgactgataatcc
caataattaccttgtgactattccgtattctcctgagtattcccttgatttagtaatgcc
aagagaagatgtaatctctatgtgccagagtgtaaacggttctaagacggcatttgtgag
ggcattcaagaataggtacttaatgtgtgcagctaaatatgccactacaaacaaggttct
ttattggtaaggaggaaacataaatgaatgacctggtaatttctgagattgcaaacgagt
gtgtgttggacagccgtagagtggcagagatgattggtaaaacacatgcacatctttgcc
gtgatattgatggatacatcgccgtcatgagtcaaaatccaaaattggattctgataaat
tcttcatcaagcagacctatacggcaggcacaggcaagcagtacaagcgttacgacatta
ccaagatgggatgcgagatggttgccaataaactcacaggacagaagggtatcatgttta
cggcaaagtacgtagaaatcttcaataagatggcagagcaaatcattgaggagcgaacgg
actcctatatgattaccgatcctgtaaagcgtgccaagaaatggattgaagaggagacgg
agcgccagaagctccgcgctgagaataaggagatgctgccgaaagcacagttctatgaca
cggttgctaatacagagtccttgttctccatggctgatgttgccaaaacattagatatgg
gcattggacgcaacaagctctttgcatttctccgtaacaagggtatccttgataaggaca
atcacccatatcagaaatatgtcgatgcaggatacttgagactcgttgaggatcattgca
aggcaggggataacgacgttgtatacaaatgtacctatgtcaaacagaagggcattgatt
atatccgtaagattctcttgaaggagcgtgaactcaatgaaatcgtggagtgattgcaat
aagccacacaggctgacactagaatacatgaggtctcagcatatcaatggatttaccaat
ggtagaccaacaaagagcttcttcaaactctacaatttcttcaaaaagcagccattggaa
gtcttgaatctgctccatgaattcctggagacgaaaccaagaaaaaatatgaacatgtca
cagcttttctatgaagctcgcaactggaacacggggactaaggtagccaagattaccaag
acaaacgaaacagattactttgcactactcaaggagatgtaatttatgacagacaataaa
ctcaaacgattccagattatcatgaatagacgcagaaacatgaatggtagattcaaagag
attgctccacaccatgctagggaaaatctcaaggtggttgctaagagggttgccgaggaa
aatgccaagcacaagaaggagaagaaacatgaataacgagtataaagacatcatcaagaa
gtgcttcccaacc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search