The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|485916.5.peg.1893: Desulfotomaculum acetoxidans DSM 771

This feature in The SEED Viewer

NCBI Taxonomy Id: 485916

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_013216 from base 1982903 to 1994136 (11234 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1889 1984315 1982903 1413 -           signal transduction histidine kinase regulating citrate/malate metabolism locus|Dtox_1870, protein_id|YP_003191339.1, gi|258515117, geneID|8428849
1890 1984561 1985121 561 + 245     1: 1   hypothetical protein locus|Dtox_1871, protein_id|YP_003191340.1, gi|258515118, geneID|8428850
1891 1985189 1985878 690 + 67     1: 1   hypothetical protein locus|Dtox_1872, protein_id|YP_003191341.1, gi|258515119, geneID|8428851
1892 1985965 1988232 2268 + 86     3: 9 5 8   Phage DNA polymerase I (EC 2.7.7.7) locus|Dtox_1873, protein_id|YP_003191342.1, gi|258515120, InterPro:IPR001098, InterPro:IPR002298, InterPro:IPR002562, geneID|8428852
1893 1988309 1989115 807 + 76         Phage antirepressor protein locus|Dtox_1874, protein_id|YP_003191343.1, gi|258515121, InterPro:IPR003497, InterPro:IPR005039, geneID|8428853
1894 1989119 1990021 903 + 3     1: 1   hypothetical protein locus|Dtox_1875, protein_id|YP_003191344.1, gi|258515122, geneID|8428854
1895 1990391 1990858 468 + 369     1: 2   Anaerobic ribonucleoside-triphosphate reductase-activating protein locus|Dtox_1877, protein_id|YP_003191346.1, gi|258515124, geneID|8428856
1896 1990836 1992740 1905 + -23     1: 2   Ribonucleoside-triphosphate reductase (formate) (EC 1.1.98.6) locus|Dtox_1878, protein_id|YP_003191347.1, gi|258515125, geneID|8428857
1897 1992796 1993308 513 + 55     4: 7 4 10 6   Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|Dtox_1879, protein_id|YP_003191348.1, gi|258515126, InterPro:IPR008180, InterPro:IPR008181, geneID|8428858
1898 1993286 1993405 120 + -23     1: 1   hypothetical protein locus|Dtox_1880, protein_id|YP_003191349.1, gi|258515127, geneID|8428859
1899 1993408 1994136 729 + 2     1: 3   SleB-like protein locus|Dtox_1881, protein_id|YP_003191350.1, gi|258515128, InterPro:IPR002482, InterPro:IPR011105, geneID|8428860

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|485916.5.peg.1893 Phage antirepressor protein
MTNALAITNEMNRIQRVFNYEGQKVRTVLINGEPWFVGVDVCNILEINNSRQAISYLDVD
EKQTIPSRSLTVINSDSQKGGAQYITIINEPGLYSLILRSRKPEAKAFKRWITHEVIPSI
RKTGAYEMPGIVKDYLAMSEEDRAIAFFKKSKEFKVLEAENKILKPKAGKYDDFLNSDGV
FDWDAISSTLDIGRNTMLLELRERGYLQKRKGNNWNLALRRYEEAGWFVTKAVSQWTDKF
GNEYPKYKTFVTPTGLDNLIELFRKWGY

MD5 = aab7bcdf434c9f39c9e1ac2d19f91f20


  DNA Sequence

>fig|485916.5.peg.1893 Phage antirepressor protein
atgactaacgcattagctattacaaacgaaatgaacaggattcaaagggtatttaattat
gagggccaaaaagtgcggacggtactgataaatggtgagccttggtttgttggagtcgat
gtatgtaatatattggaaataaataatagtcgtcaagctatttcatacttagatgttgat
gaaaaacagacaataccgtcccggagtttgaccgtcattaatagtgacagtcaaaaaggt
ggagcacagtatattaccataataaacgaaccgggcttatattctttaattcttagaagt
cgtaaaccagaagcaaaagcattcaaacgctggatcactcacgaggttattccctccatt
cgcaaaacaggggcatatgaaatgccgggaattgttaaagactatttggccatgtcagaa
gaagatcgggcgattgcgttttttaaaaagtcgaaggaatttaaagtcttggaagcagag
aataaaattttaaaacccaaggccggtaaatatgacgacttcttgaacagcgatggagta
ttcgattgggacgcaatttcaagcaccttggatataggaagaaacacaatgcttcttgaa
ctccgggaaagaggttacttacaaaagagaaagggtaataactggaacttagctctccgc
cgctacgaggaagctggttggttcgtgacaaaggccgttagccagtggacagataaattt
ggcaatgaataccccaaatataaaacatttgttactccaaccgggctggataatttaatt
gagctgttcaggaaatgggggtattaa


  DNA with Flanking Sequence

>fig|485916.5.peg.1893 Phage antirepressor protein
ctacgataagctggccactgagatatgtgagatactgggaaccaaagctgtgccttatga
ttactggcaatataaaaaggagttgcctgttatactacgcaggcaattccgggcagttaa
aggggaagtggaacgggtacgccggatggctgtaaacgcgagaattcaaggaacagccgc
agacattatgaaaagagctttaatcaacctttataacgatggtaggaagattattggtac
ggtgcacgatgaggctcttttgatagttaacaaaaatattactcttgccgaggtggaaaa
aatcgaagcctgcatgataaggtctgcaaaccttaacgttcctattcgtgttgacactga
actttccacccgctggggtacaggaattaagaagggagcttactttaatggaaatgttgc
gtgaaatagaactggctgatagcaagggtgttacctacatggcagataaaaatctgaatt
atgaaatgggaggaaataaaatgactaacgcattagctattacaaacgaaatgaacagga
ttcaaagggtatttaattatgagggccaaaaagtgcggacggtactgataaatggtgagc
cttggtttgttggagtcgatgtatgtaatatattggaaataaataatagtcgtcaagcta
tttcatacttagatgttgatgaaaaacagacaataccgtcccggagtttgaccgtcatta
atagtgacagtcaaaaaggtggagcacagtatattaccataataaacgaaccgggcttat
attctttaattcttagaagtcgtaaaccagaagcaaaagcattcaaacgctggatcactc
acgaggttattccctccattcgcaaaacaggggcatatgaaatgccgggaattgttaaag
actatttggccatgtcagaagaagatcgggcgattgcgttttttaaaaagtcgaaggaat
ttaaagtcttggaagcagagaataaaattttaaaacccaaggccggtaaatatgacgact
tcttgaacagcgatggagtattcgattgggacgcaatttcaagcaccttggatataggaa
gaaacacaatgcttcttgaactccgggaaagaggttacttacaaaagagaaagggtaata
actggaacttagctctccgccgctacgaggaagctggttggttcgtgacaaaggccgtta
gccagtggacagataaatttggcaatgaataccccaaatataaaacatttgttactccaa
ccgggctggataatttaattgagctgttcaggaaatgggggtattaaaacatgacattat
ttaaccgggctggagccaggcaacttcgcgaggaagtagttgagagccacattgataata
agctggctgatgcaatactggaacattttaatgaaatccactccatggagttaccagtgg
atttcgagatagaacgaagtttattaaaagatgagttagattcaataaaccgaaaatctc
agtttttcttcactaacgaaatgattacattctcaccctcgtcagcttcgaagtgtgagc
gggagctactatttaaagccatcagcacaaccaaggataacaactcctttttcccttacc
agcgacgttggatgagaaatggtacggctgtacatgccgctgttcagaaggatttactct
atgctgaaaaatacctggacaatcctaaatttacagtagaacggacagtagaaggtaagc
cagcctgggaaagaaacatcaaaaaatctaaacagtttaatcataatggagttagcttcc
ttatata


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search