The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|485916.4.peg.774: Desulfotomaculum acetoxidans DSM 771

This feature in The SEED Viewer

NCBI Taxonomy Id: 485916

Current Assignment: Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)
Translate Function Assignments



Context on contig 4082966.C148 from base 14 to 3038 (3025 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
771 14 748 735 +           Phage antirepressor protein  
772 752 1654 903 + 3         hypothetical protein  
773 2171 2491 321 + 516         Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)  
774 2469 3038 570 + -23         Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|485916.4.peg.774 Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)
MKLSATFEPGFDKLYSKFASDPVGLQLLDIEGISPRKVDVGQMSHDYFTKRLADASVDVN
ANANEELSANNYQAEVTKGILKLEGYYLLWRYSKKRFGIRRANELIKAIWDGELYFHDAS
GHGVILPYCFAYSTANLMVEGRKYGQLHSLPPKRSDSFVAQLSKPQWIYRKNSWGLWLLV
ILLLTSAGT

MD5 = f581f7221930de3f24861e9ac270ba16


  DNA Sequence

>fig|485916.4.peg.774 Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)
atgaaactatcggcaacatttgaacctggctttgataagctctacagcaaattcgccagc
gaccctgtaggactccagttgcttgatattgaggggatttctcctcgcaaggtagatgtt
gggcaaatgtcccatgactattttaccaaacgtctggctgatgcttcagttgatgtgaac
gctaatgctaatgaggaactatcggccaacaactaccaggccgaagtaaccaaaggtatt
ctcaagctggaaggatattatctgctctggcggtactcgaaaaagagattcggtatacgc
cgggccaacgagttaattaaagctatatgggatggtgagttatatttccacgatgccagc
gggcatggagtgatcttgccgtattgttttgcgtattctaccgctaaccttatggtggag
ggcaggaaatatggtcagcttcacagcctgccgccaaagcgttcagattccttcgtggct
cagttatcgaaaccacaatggatttatcgcaagaattcgtgggggctgtggctcctggtg
attttattgttaacctctgctggtacttag


  DNA with Flanking Sequence

>fig|485916.4.peg.774 Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)
ataccaattaaccaatcaactaaatcaaaaagttagtttgagggggaatagtgctgtgaa
agttcggattggtgggctaaacgaaatgagcttaattgatgccgaaggacttattgccta
cagcatatttattcaaggatgccaccgtaggtgcgagggttgccacaatccaagtctgca
accttttgagggtggcgaggaaatggataccagcgaaattatagatgaaatctggcgtaa
ccgtgattactacgagtctgtggtgtttgttggtggtgagccattagaccagccggaatc
cttaaaggaactgttaaaattcgtaaacggtacaaatatggaagcctggctgtatactgg
ctattactcagatgaaatacccgctgatattttcgaacttgctgatgttatcgtggccgg
gccatatatcgaaaagtataaaactaacggatttccggccagtgccaatcaagtaattat
tgacaacagggggtctaaaaatgaaactatcggcaacatttgaacctggctttgataagc
tctacagcaaattcgccagcgaccctgtaggactccagttgcttgatattgaggggattt
ctcctcgcaaggtagatgttgggcaaatgtcccatgactattttaccaaacgtctggctg
atgcttcagttgatgtgaacgctaatgctaatgaggaactatcggccaacaactaccagg
ccgaagtaaccaaaggtattctcaagctggaaggatattatctgctctggcggtactcga
aaaagagattcggtatacgccgggccaacgagttaattaaagctatatgggatggtgagt
tatatttccacgatgccagcgggcatggagtgatcttgccgtattgttttgcgtattcta
ccgctaaccttatggtggagggcaggaaatatggtcagcttcacagcctgccgccaaagc
gttcagattccttcgtggctcagttatcgaaaccacaatggatttatcgcaagaattcgt
gggggctgtggctcctggtgattttattgttaacctctgctggtacttagaacgtgaggc
cgttgacccgtgggcaagcgagggccggagtatattgagatcagtggcaaaatcgtgcat
ggtgatggatacagttcagagtatcgggacgagtcctttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
tr|C1TJT1 Desulfotomaculum acetoxidans DSM 771 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search