The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|471872.6.peg.1268: Streptococcus infantarius subsp. infantarius ATCC BAA-102

This feature in The SEED Viewer

NCBI Taxonomy Id: 471872

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_DS572693 from base 110318 to 120181 (9864 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1263 111112 110318 795 -           Hypothetical secreted protein locus|STRINF_01513, protein_id|ZP_02920632.1, gi|171779676
1264 111596 111396 201 - 283         hypothetical protein locus|STRINF_01515, protein_id|ZP_02920634.1, gi|171779678
1265 112381 111599 783 - 2         putative prophage LambdaSa1, repressor protein locus|STRINF_01516, protein_id|ZP_02920635.1, gi|171779679, InterPro:IPR001387, InterPro:IPR010982, InterPro:IPR011056, InterPro:IPR015927
1266 113803 113099 705 - 717         hypothetical protein locus|STRINF_01519, protein_id|ZP_02920638.1, gi|171779682
1267 114776 115336 561 + 972         hypothetical protein locus|STRINF_01524, protein_id|ZP_02920643.1, gi|171779687
1268 115333 116049 717 + -4       Phage antirepressor protein locus|STRINF_01525, protein_id|ZP_02920644.1, gi|171779688, InterPro:IPR005039, InterPro:IPR013557
1269 116316 116621 306 + 266         putative excisionase locus|STRINF_01526, protein_id|ZP_02920645.1, gi|171779689
1270 116623 116799 177 + 1         hypothetical protein locus|STRINF_01527, protein_id|ZP_02920646.1, gi|171779690
1271 116912 117796 885 + 112         DNA replication protein dnaD locus|STRINF_01528, protein_id|ZP_02920647.1, gi|171779691, InterPro:IPR006343, InterPro:IPR010056
1272 117799 118053 255 + 2         hypothetical protein locus|STRINF_01529, protein_id|ZP_02920648.1, gi|171779692
1273 118420 119358 939 + 366 4 1: 1   Recombinational DNA repair protein RecT (prophage associated) locus|STRINF_01532, protein_id|ZP_02920651.1, gi|171779695, InterPro:IPR004590
1274 119351 120181 831 + -8 5     hypothetical protein locus|STRINF_01533, protein_id|ZP_02920652.1, gi|171779696

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|471872.6.peg.1268 Phage antirepressor protein
MNELIRIDFKGDSATVSARDLYRSLEVKTRFSQWVEQNFKMFKENEDFSSVVTTTQQNQY
GGVKKLQDYAVSIRMAEHLAMMSKTSKGYEVREYFIQVEKDFNSPEKIMARALKIADRKI
IKLEATIEEQKPKVIFANAVSASHTSILVGDFAKLMRQNGLNFGQNRMFAWLRENGYLIS
RKGKSWNMPTQKAMDLGLFEIKETTINHSDGHISINKTPKITGKGQLYFADKLLNNIA

MD5 = 8ff2976af18ee10168f0220b9492dc6e


  DNA Sequence

>fig|471872.6.peg.1268 Phage antirepressor protein
atgaatgagttaattcgtatagatttcaaaggtgatagtgctactgtctcggctcgtgac
ttatatagaagtttagaggttaaaactcgtttcagtcagtgggtcgagcaaaacttcaaa
atgtttaaagagaacgaagattttagctctgtagttacaactacacagcaaaatcaatat
ggcggagttaaaaaattacaagattacgctgttagtattcgcatggctgaacatttagca
atgatgtctaaaacttcaaaagggtacgaagtcagagaatacttcattcaagttgaaaag
gacttcaacagtcctgagaaaatcatggctcgagctcttaaaattgctgaccgtaaaatt
attaaacttgaagcaacaattgaagagcaaaaacctaaagttatctttgctaacgcagtc
agcgcaagtcatacgtctattttagtcggtgactttgctaagctcatgcgtcagaacggc
ttgaattttggtcagaatcgtatgtttgcatggctgcgagaaaatggctatctaatcagt
cgcaaaggcaaaagttggaacatgccaacacaaaaagcaatggatttaggtctgtttgaa
atcaaagaaacgactatcaatcattcagacggtcatatcagcattaacaagacacctaaa
attacaggtaaagggcaattgtattttgctgataagctactgaataacattgcttaa


  DNA with Flanking Sequence

>fig|471872.6.peg.1268 Phage antirepressor protein
gaattgtttttgtgggcagctagagaaaagcaaaaatgcaattacaactcacaacaaatc
aaaaggttaagaacttttatcaaagataaatatctgaataagtttcaaggaacaatatat
ctcattgactttttagacttggaattcattcacgctctagaatgtgaaaacagcagggaa
aatcgtgaaaaggatatgcagagttatatctgtcaaaacttcgaaacactattccctaat
tttgaattcgtaaaaagtgaatttgtaataaaaagtggtcgaattgacattttagctgaa
gaaaaaagcagcaagagaccagtgattattgaattgaaaacagataataaaaatccgact
attcaattattagcctattcaaaagaatttatcaatccaattttaataggggttaccgag
aagaaactcgccaattcaaaaatggacgacgatattacatattatgttatgaaaaataaa
aaaatggaagaggtgattaaatgaatgagttaattcgtatagatttcaaaggtgatagtg
ctactgtctcggctcgtgacttatatagaagtttagaggttaaaactcgtttcagtcagt
gggtcgagcaaaacttcaaaatgtttaaagagaacgaagattttagctctgtagttacaa
ctacacagcaaaatcaatatggcggagttaaaaaattacaagattacgctgttagtattc
gcatggctgaacatttagcaatgatgtctaaaacttcaaaagggtacgaagtcagagaat
acttcattcaagttgaaaaggacttcaacagtcctgagaaaatcatggctcgagctctta
aaattgctgaccgtaaaattattaaacttgaagcaacaattgaagagcaaaaacctaaag
ttatctttgctaacgcagtcagcgcaagtcatacgtctattttagtcggtgactttgcta
agctcatgcgtcagaacggcttgaattttggtcagaatcgtatgtttgcatggctgcgag
aaaatggctatctaatcagtcgcaaaggcaaaagttggaacatgccaacacaaaaagcaa
tggatttaggtctgtttgaaatcaaagaaacgactatcaatcattcagacggtcatatca
gcattaacaagacacctaaaattacaggtaaagggcaattgtattttgctgataagctac
tgaataacattgcttaattaaccgtgcttctcagactggttgatacggctctagtaggtg
attactcataaatatcaatttgactatgtttgattttcctttaccaatatagatttttta
atcatttacacgatagtatctcctatttattctttaatcggctgaaaagtgcctactagg
gccataccagccagtctgagagcataaaaaaacgactgacggcaatcagtcgcataacaa
ataaaactaaagtaaattataccacattaaaaaggagcacgctatgccaaaggtcgaaat
aacttacaaggctgtcggtgttaacgaagatgctgaatggggcgactatgatcatctcat
gcaacgctgggagggcttaactaaatcagttgcgaaacaatgggcagctgaaatgcgtga
gcatccagaatttaggaaatatgtcgacaatccaacgcataaaattgttttcatcaatta
tgaaggttttgcacttttcgtaaagtggaaatcacgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EDT47224.1 Streptococcus infantarius subsp. infantarius ATCC BAA-102     hypothetical protein STRINF_01525
gi|171281790 Streptococcus infantarius subsp. infantarius ATCC BAA-102 NCBI   hypothetical protein STRINF_01525
gi|171779688 Streptococcus infantarius subsp. infantarius ATCC BAA-102 NCBI   hypothetical protein STRINF_01525
img|642347073 Streptococcus infantarius infantarius ATCC BAA-102 IMG   hypothetical protein
ref|ZP_02920644.1 Streptococcus infantarius subsp. infantarius ATCC BAA-102 RefSeq   hypothetical protein STRINF_01525
tr|B1SFR0 Streptococcus infantarius subsp. infantarius ATCC BAA-102 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|471872.6.peg.1273 Recombinational DNA repair protein RecT (prophage associated)
5 fig|471872.6.peg.1274 hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search