The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|469605.3.peg.258: Fusobacterium sp. 3_1_5R

This feature in The SEED Viewer

NCBI Taxonomy Id: 469605

Current Assignment: FIG00670543: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657971 from base 80760 to 95978 (15219 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
249 80760 81521 762 +           Phage antirepressor protein  
250 81561 81749 189 + 39         hypothetical protein  
251 82224 82433 210 + 474         hypothetical protein  
252 82597 82761 165 + 163         hypothetical protein  
253 82885 83397 513 + 123         hypothetical protein  
254 83397 84992 1596 + -1         hypothetical protein  
255 85196 85543 348 + 203         hypothetical protein  
256 85606 86010 405 + 62         hypothetical protein  
257 86024 86206 183 + 13         hypothetical protein  
258 86401 87351 951 + 194         FIG00670543: hypothetical protein  
259 87465 87815 351 + 113         FIG00669821: hypothetical protein  
260 87835 88809 975 + 19         FIG00669796: hypothetical protein  
261 88814 89152 339 + 4         FIG00671864: hypothetical protein  
262 89149 89589 441 + -4         FIG00670688: hypothetical protein  
263 89604 90560 957 + 14         FIG00671820: hypothetical protein  
264 90577 90966 390 + 16         FIG00671569: hypothetical protein  
265 91050 91232 183 + 83         hypothetical protein  
266 91278 95978 4701 + 45         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|469605.3.peg.258 FIG00670543: hypothetical protein
MKKRLKVFESGNYPQGNFEADRVKAVFEKVVDKIPGIFAHSSHWAKKEEEPVSVGEFSNF
ELLNKNGKLVVFGDVEFNEKGAGYYNDKILEGVSVEIDPKTNTLHKIAVLPKGVKPQVAG
AEFELKEDELQGIYLQFEEFEEEKMTLEQIMATFPVLSLDDRAKLINSLVSTVTDEERNG
MRKLMEWEKVEAIQVEPKVPKTEDEIRAEITAQMEFEAKRNQLIEKAKAKFTPAQQEIME
FALKKAGEERTTVLEFESNGKKENMSYFERFEKAVETMEDAANFTSKTKELEFENKEEKT
DAMKQAYDRTKARFSK

MD5 = 27c2b6791b11f87b27de64069b4c7860


  DNA Sequence

>fig|469605.3.peg.258 FIG00670543: hypothetical protein
atgaaaaaaagattgaaagtgtttgaaagtggtaattatcctcaaggaaattttgaagca
gacagagtgaaagctgtttttgaaaaagttgtggataaaattccgggtatttttgcccac
agttcacattgggcaaagaaagaagaagaacctgtttcagttggagaattctctaatttc
gaacttttgaataaaaatggaaagttggttgtatttggagatgtagagttcaatgaaaaa
ggagcaggatattacaatgacaagattttggagggagtatctgtagaaatagatcctaag
acaaatactttacacaaaattgcagtattgccaaagggtgtaaaaccacaggttgctgga
gcggaatttgagttaaaagaagatgaactacaagggatttatttacaatttgaagaattt
gaggaggaaaaaatgacactagaacaaattatggcaacattcccagttctttctttagac
gacagagcaaaattaatcaatagtttggtttcgactgttactgatgaagaaagaaacgga
atgagaaagcttatggaatgggaaaaagtggaagcaattcaagtagaaccgaaagttccg
aaaacagaagatgaaattcgagcagaaatcacagctcaaatggaatttgaagcaaaaaga
aatcaattgattgaaaaggcaaaagcaaaattcactccagcacaacaagaaatcatggaa
tttgcattaaaaaaagcaggagaagaaagaacaactgttttagaatttgaatctaacgga
aagaaagaaaatatgtcttattttgaaagatttgaaaaagcggtagaaacaatggaagac
gctgctaattttacaagcaagacaaaagaattagaatttgaaaacaaagaagaaaaaaca
gatgcaatgaagcaagcttatgatagaacaaaagctagattttcaaaatga


  DNA with Flanking Sequence

>fig|469605.3.peg.258 FIG00670543: hypothetical protein
taaagcttgatgaaacagaaccggaaaatttgagaattttcttcgaaaatctaggaacat
taaaccactatgttgggttttggcttctagagcaaaaagtgagaaattaaaagggagatt
aaaatggcagaacatggaggaaaaagggaaggggctggaagacctgcttctcgtgataaa
aagatacaaaaatcaataaaaatagatccaaccatctacaaacagatagaacagttggac
ggaaccttcatttctaaaatagaaagaggtctagaattactcttagaaaaagagtacaaa
aaataaaaaagagaataaataaagaaagactgtagataaaaatgtttgcagtcttttttt
atttttttgaaaaaacaatatactgttttcgtctttttttatgtttttttctaaaaaagc
ataaaagatacaaaaaaattaacaaaattgttaaccctcatctattagtagagagcatag
tgcgagggaggtgactaagaatgaaaaaaagattgaaagtgtttgaaagtggtaattatc
ctcaaggaaattttgaagcagacagagtgaaagctgtttttgaaaaagttgtggataaaa
ttccgggtatttttgcccacagttcacattgggcaaagaaagaagaagaacctgtttcag
ttggagaattctctaatttcgaacttttgaataaaaatggaaagttggttgtatttggag
atgtagagttcaatgaaaaaggagcaggatattacaatgacaagattttggagggagtat
ctgtagaaatagatcctaagacaaatactttacacaaaattgcagtattgccaaagggtg
taaaaccacaggttgctggagcggaatttgagttaaaagaagatgaactacaagggattt
atttacaatttgaagaatttgaggaggaaaaaatgacactagaacaaattatggcaacat
tcccagttctttctttagacgacagagcaaaattaatcaatagtttggtttcgactgtta
ctgatgaagaaagaaacggaatgagaaagcttatggaatgggaaaaagtggaagcaattc
aagtagaaccgaaagttccgaaaacagaagatgaaattcgagcagaaatcacagctcaaa
tggaatttgaagcaaaaagaaatcaattgattgaaaaggcaaaagcaaaattcactccag
cacaacaagaaatcatggaatttgcattaaaaaaagcaggagaagaaagaacaactgttt
tagaatttgaatctaacggaaagaaagaaaatatgtcttattttgaaagatttgaaaaag
cggtagaaacaatggaagacgctgctaattttacaagcaagacaaaagaattagaatttg
aaaacaaagaagaaaaaacagatgcaatgaagcaagcttatgatagaacaaaagctagat
tttcaaaatgataggaggagtaaatgaccaaaataggaattttcatgtttgtgttagcag
taattggaattgcagcacatttttggaataaaaaacataatgacagaaaaggaggaaaaa
aataatggctagatatgacagaaaagaaaaagagttagtacaaattgtagaagacactct
tactatagctggagtagtgaaacaagatgaagatgtcaacctttattctttagttgcata
taatcattcagaagacaaatgggttaaatttgtaaaagaaacacataaaactggatttgc
agtagcaatggtaaaacaagcaaaaggaatcgaatttgacaatactggaaaagatgttgt
ggttccattattaaaaattggaattgtaaataaagaagtagtaaaaaaggcattttcaga
attagatcaagaaacagtaggaatttgtttggcacaaggattagcaattctttaatgaga
aaaggaggaaatgaatgttaacagaaaaaca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gi|257451508 Fusobacterium sp. 3_1_5R NCBI   hypothetical protein F3_00492
ref|ZP_05616807.1 Fusobacterium sp. 3_1_5R RefSeq   hypothetical protein F3_00492


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search