The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|469605.3.peg.252: Fusobacterium sp. 3_1_5R

This feature in The SEED Viewer

NCBI Taxonomy Id: 469605

Current Assignment: hypothetical protein
Turn Off Function Translation



Context on contig NZ_GG657971 from base 77583 to 87815 (10233 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
241 77583 78050 468 +           hypothetical protein  
242 78066 78527 462 + 15         hypothetical protein  
243 78640 78810 171 + 112         hypothetical protein  
244 78928 79050 123 + 117         hypothetical protein  
245 79047 79613 567 + -4         putative antirepressor  
246 79758 79946 189 + 144         hypothetical protein  
247 80186 80359 174 + 239         hypothetical protein  
248 80472 80747 276 + 112         hypothetical protein  
249 80760 81521 762 + 12         Phage antirepressor protein  
250 81561 81749 189 + 39         hypothetical protein  
251 82224 82433 210 + 474         hypothetical protein  
252 82597 82761 165 + 163         hypothetical protein  
253 82885 83397 513 + 123         hypothetical protein  
254 83397 84992 1596 + -1         hypothetical protein  
255 85196 85543 348 + 203         hypothetical protein  
256 85606 86010 405 + 62         hypothetical protein  
257 86024 86206 183 + 13         hypothetical protein  
258 86401 87351 951 + 194         FIG00670543: hypothetical protein  
259 87465 87815 351 + 113         FIG00669821: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|469605.3.peg.252 hypothetical protein
MKDFSLVTTKKISDYDIVEYLKENFSEYDDVDIEKSFIEELYFYSDIFIKRHWK

MD5 = 89ff67f86843efaefcca57d62bb5d485


  DNA Sequence

>fig|469605.3.peg.252 hypothetical protein
atgaaagatttttctttagtaacgactaagaaaatttctgactatgatatagtggaatac
ttaaaagaaaatttttctgaatatgatgatgtagacatagaaaaatcttttatagaagaa
ctttatttttattccgatatctttataaaaagacattggaaataa


  DNA with Flanking Sequence

>fig|469605.3.peg.252 hypothetical protein
tttataaatggattaaaaataaaaaaaaataaggattcctaacaaaacgttaacaatcct
tatttcatatgcgttcttggtatctttataatacatcttttttaataaaaagtcaaggag
gaaatacgtgtcagagaagaaaagaaaagggtattctacaatcgagcaacaaatgagagc
taataaagaatatctagatagaaatccagaagcaaaggaaagaggaaatcgaagcagatt
aaaaagcacttgcaaaagatttatacgtgattttgccactttagaagagttagaagaaat
aaaagttttaatagcagaaaggagtacaaaaaaatgaaaatcataaagcagattgcaatt
ttttaaaaaataaaaattctgggtatagtgtattttttccagaatatccacatttattta
cttgtggaggtccttccaaagaaaatgctcggtatatgtcaaaagatagattgtgtagcg
aaatcagttataatcattatatgaaagatttttctttagtaacgactaagaaaatttctg
actatgatatagtggaatacttaaaagaaaatttttctgaatatgatgatgtagacatag
aaaaatcttttatagaagaactttatttttattccgatatctttataaaaagacattgga
aataaaagattggagcaagaataaaatcctgttcttttttttaaaaataaaaaaaagttg
ttgacatttacttgattatagtatatacttaaatcaagataagaaatgaagaaaaggaga
gatgtaaaatgttagtaaaagatatgaaaaacggtttattagtgaatgcggtgattgact
ttataaatttcttaagagatgaaaacgaatttaattataaattcgtatctgaaaatcaag
agattttctatactgatggttgtaaagcaattatgaatttacaattaaataaagaaaaat
ataaaaataacaaaagtcaaaatttccttttctcgttttctagaattttaaaagatatga
atgaagatgatgaattaaaaaaagaactatcagaattcatacttgaatatttaaaagaaa
ccaacaactataatgaagaaatgaaaggatatattgtaaattcatatgtaactttagatg
tattaactgaaacagttgacgttga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search