The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|469605.3.peg.244: Fusobacterium sp. 3_1_5R

This feature in The SEED Viewer

NCBI Taxonomy Id: 469605

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657971 from base 72846 to 84992 (12147 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
236 72846 75368 2523 +           hypothetical protein  
237 75372 75596 225 + 3         hypothetical protein  
238 75629 76210 582 + 32         hypothetical protein  
239 76530 77054 525 + 319         DNA repair protein radC  
240 77423 77145 279 - 90     1: 1   DNA-binding protein HU  
241 77583 78050 468 + 159         hypothetical protein  
242 78066 78527 462 + 15         hypothetical protein  
243 78640 78810 171 + 112         hypothetical protein  
244 78928 79050 123 + 117         hypothetical protein  
245 79047 79613 567 + -4         putative antirepressor  
246 79758 79946 189 + 144         hypothetical protein  
247 80186 80359 174 + 239         hypothetical protein  
248 80472 80747 276 + 112         hypothetical protein  
249 80760 81521 762 + 12         Phage antirepressor protein  
250 81561 81749 189 + 39         hypothetical protein  
251 82224 82433 210 + 474         hypothetical protein  
252 82597 82761 165 + 163         hypothetical protein  
253 82885 83397 513 + 123         hypothetical protein  
254 83397 84992 1596 + -1         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|469605.3.peg.244 hypothetical protein
MRMKKMNSDFWECSFKGIVFYVKNPNQAIEIAWRMSGGRV

MD5 = 50a0422df6ae7b1a1c0de8fc3fe61a49


  DNA Sequence

>fig|469605.3.peg.244 hypothetical protein
atgagaatgaaaaaaatgaattctgatttttgggaatgtagttttaaaggaattgtattt
tatgttaaaaatcctaatcaggcaatagaaattgcatggagaatgagtggtggtagagta
tga


  DNA with Flanking Sequence

>fig|469605.3.peg.244 hypothetical protein
agatgttgaagaatatgtttctattatgttggaagatagaggagaaaagatagaaagaaa
atataatatgtggacaggagaatgggaaagtggggaataaattaaagagagcctatgggc
tctttttttttatttgattaaaaaaaactcttgatttttgtattgagatacaatataatg
tattaagatacagaaaggggtgatgaaagcttttgactaaaagtagagcagactatttca
gagagcgaagaaagaaattgaaagagttcggagtagtggttgatagagaaaaattagaaa
ctctcgaaaaaaaattaaaagaaaaaaacagaactaagacagcttggctcaatgaaaaaa
ttgatgaagaattaaaaaaatagagaatcacttacagttcttggcggaacagtgattctc
taagagtgaaagatttctctttcaaaattattgtatcataaaaagagatttctttcaatt
tatattgaaaggagttaaaaatgagaatgaaaaaaatgaattctgatttttgggaatgta
gttttaaaggaattgtattttatgttaaaaatcctaatcaggcaatagaaattgcatgga
gaatgagtggtggtagagtatgaaatataatccagaactcataaagaaaaataatgtcta
tgtagtaagtagtagagcaattgctaaggaattaggaaaaagacacgataacgtagtaag
ggatattgaaaatttaatctcctcagatgtgaggagattaaaaaaacaatcaaatgacat
tttggcagatttagaaaaaatgttaattcaaagtcaatatcgagatagcaagaatagaaa
ttatagagaatatcttttaacaaaagacggctttactttatatatgttcaatattcaagg
atataatgactttaaaatagcatatatcaatgaatttaacagaatggagagagctttaaa
acaacaagcactaccactagaaaataaagtaagaattgaagacatgacttttgaacagac
aatgcgaacagtcaaaggtattgtgaacaatttaaaatctaggttagtccatgaacgtga
tattttaaatatgaaaatatctgaattagacaagacaggacta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gi|257451492 Fusobacterium sp. 3_1_5R NCBI   hypothetical protein F3_00412
ref|ZP_05616791.1 Fusobacterium sp. 3_1_5R RefSeq   hypothetical protein F3_00412


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search