The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|469605.3.peg.233: Fusobacterium sp. 3_1_5R

This feature in The SEED Viewer

NCBI Taxonomy Id: 469605

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657971 from base 65854 to 76210 (10357 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
224 65854 66462 609 +       15: 10 12 1 11 13 2 8 6 15 14 4 5 9 3 7   Putative preQ0 transporter  
225 66640 67137 498 + 177         DNA modification methylase  
226 67134 67379 246 + -4         hypothetical protein  
227 67481 67681 201 + 101         hypothetical protein  
228 67695 68099 405 + 13         hypothetical protein  
229 68133 68942 810 + 33         Phage antirepressor protein  
230 68929 69732 804 + -14         hypothetical protein  
231 69708 69962 255 + -25         hypothetical protein  
232 70204 71136 933 + 241         hypothetical protein  
233 71133 71468 336 + -4         hypothetical protein  
234 71453 72157 705 + -16         terminase, large subunit  
235 72205 72834 630 + 47         Phage terminase, large subunit  
236 72846 75368 2523 + 11         hypothetical protein  
237 75372 75596 225 + 3         hypothetical protein  
238 75629 76210 582 + 32         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|469605.3.peg.233 hypothetical protein
MTHKDSKSFFENFIQEDSAFHKYKISKSMEERLKIKNVLIEMIISGELKPFSELERNVWV
LYREGISSEEIQNRLGISKSMYGVVKYRAGKKIEKFAEKFKERSERLCCEI

MD5 = 5c0fa0180305ff39878cf51c7be54f83


  DNA Sequence

>fig|469605.3.peg.233 hypothetical protein
atgacacacaaagattctaaaagtttttttgagaattttatacaagaagattctgcattt
cataaatataaaattagcaaaagcatggaagaaagattaaaaataaaaaatgttcttatt
gagatgattatttcaggagaactgaaaccattttctgaattagaaagaaatgtatgggta
ttatatagagaggggatttcttcagaagaaatacaaaatagattaggaatttcaaaatca
atgtatggtgtcgtaaagtatcgtgctgggaagaaaatagaaaaatttgcagaaaaattt
aaggaaagaagtgagcgattatgttgcgaaatatga


  DNA with Flanking Sequence

>fig|469605.3.peg.233 hypothetical protein
agaaaacgttacaatttaattcaacggagagatgagctacaattagaagcacaagctaga
atagcagaagtaatcacaaaagaaagagaaaaaagagcgttacaactaataaaaggtgca
gaatatttagaaggtgtagcattagagaaaataaaagattttcacacgggaaaacatgga
gcgagtgagggaaagaaattagcggcagaaatcaatgctataaaacaaggattagaaaca
ttagacgctgctaaaagatatacggattcttggataggagcaggaaatgcaaaagaagta
tcagatttgatgttacaagatagaaaatacgaattagagcaagaaagatttgcatttgag
aaagagaaagcaacagcaatgttgtatacaaagttgttagaaatagaaaaaggtaataaa
gaaaatacaagcgaagaaattcgtggagcaattgaagaacaatttggaaattgggaaata
gatacgtgggaggaaacagaatgacacacaaagattctaaaagtttttttgagaatttta
tacaagaagattctgcatttcataaatataaaattagcaaaagcatggaagaaagattaa
aaataaaaaatgttcttattgagatgattatttcaggagaactgaaaccattttctgaat
tagaaagaaatgtatgggtattatatagagaggggatttcttcagaagaaatacaaaata
gattaggaatttcaaaatcaatgtatggtgtcgtaaagtatcgtgctgggaagaaaatag
aaaaatttgcagaaaaatttaaggaaagaagtgagcgattatgttgcgaaatatgattcg
cattgttagcactgaatataaaaacacggtactacgaaaaagaaataaacttttagaaga
tagttttaaaatgatagagccaagtttaaaacaaagaaaggtattgacttggtggagaga
tagcagtccgtataaaaattattttggtattatatgcgacggagcaattcgaagtgggaa
aactgcttcggttatttatagtttcatgacttggagtatgacaaattttaatagacagaa
ttttatattatctggaaaaacaataggagcgtttaagagaaatatcttaaaagatttagt
tagaatgttgcgaacattgaaatttgaatattcctataatcgttctgataatgttttagt
cgttacacttggagaagtaacgaattactattatgtatttggtggaaaagatgagaaatc
agcagatttggtacaagggttaacagcagctggggctttttttgacgaagcagtgctaat
gccaaagaatttttta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gi|257451483 Fusobacterium sp. 3_1_5R NCBI   hypothetical protein F3_00357
ref|ZP_05616782.1 Fusobacterium sp. 3_1_5R RefSeq   hypothetical protein F3_00357


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search