The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|457393.3.peg.3247: Bacteroides sp. 4_1_36

This feature in The SEED Viewer

NCBI Taxonomy Id: 457393

Current Assignment: putative antirepressor
Translate Function Assignments



Context on contig NZ_GL622506 from base 330747 to 342581 (11835 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3243 330747 332087 1341 +           Conjugative transposon protein TraG  
3244 332338 334848 2511 + 250         FIG00898215: hypothetical protein  
3245 334863 335588 726 + 14         FIG00897793: hypothetical protein  
3246 335616 336380 765 + 27         FIG00404777: hypothetical protein  
3247 336424 337254 831 + 43         putative antirepressor  
3248 337270 337671 402 + 15         FIG00412613: hypothetical protein  
3249 337671 337886 216 + -1         Conjugative transposon protein TraJ  
3250 338452 338784 333 + 565         putative excisionase  
3251 338817 339308 492 + 32         hypothetical protein  
3252 339589 340035 447 + 280         hypothetical protein  
3253 340317 340760 444 + 281         hypothetical protein  
3254 340763 342022 1260 + 2         conserved hypothetical protein with relaxase/mobilization nuclease domain  
3255 342045 342581 537 + 22         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|457393.3.peg.3247 putative antirepressor
MNDIQIFNNEEFGAVRTTGTPEQPLFCLADVARVLGLKTSKLVQRLSDDVLSKYPISDSL
GREQVTNFINEDGLYDVILDSRKPEAKRFRKWVTSEVLPSIRKHGAYMTQQTIEKALAEP
DFLIRLAVNLKEERQKRLLVEQECEHQRTRIVELGSKVDDLQQEVTEMKDKVSYLDIILA
TKSSVLVTQIAQDYGESSIRFNRRLKEMNIQYQRGKQWILYADYKDCGYVTSETYLIKHK
DGTEDVRMNTKWTQKGRRFLYEKLKSVGVIPVIERT

MD5 = 586ed2651750235cf5b7815cf98d07e1


  DNA Sequence

>fig|457393.3.peg.3247 putative antirepressor
atgaacgatattcagattttcaacaacgaggaatttggagcagtccgaaccacaggaaca
ccagagcaacccttgttctgtttggctgatgtggcaagagttcttggactaaaaaccagc
aagttggtacaacgactttcggatgatgtactttcaaagtaccccatctcggatagtctt
ggaagagaacaggttacaaactttatcaatgaagacggactgtatgatgtcatccttgac
agtcgcaaacccgaagccaaacgtttccgcaagtgggtgacatcggaggtgctcccctct
atccgcaagcatggtgcctatatgacacagcagaccatcgagaaggcattggcagagcca
gacttcctgatacggttagcagtcaatctgaaggaagaacgacaaaagcgtctgcttgtc
gaacaggagtgtgaacaccaaaggacacgcatcgttgagttgggatccaaggtggatgac
ctgcaacaggaggtgacggagatgaaggacaaggtgagttaccttgacatcatccttgcc
acgaagagcagtgtcctggtcacacagatagcacaggactatggcgagtcgtccatccgc
ttcaaccgacgtctgaaggagatgaacatccagtatcagcgtggcaagcagtggattctg
tatgccgactacaaggactgcggttatgtgaccagcgagacctacctcattaaacacaag
gacggtacggaggatgtgcgcatgaacaccaaatggacacagaaaggtcgccgcttcctc
tatgagaaactgaagagcgtgggagtcattcctgttatcgaaagaacataa


  DNA with Flanking Sequence

>fig|457393.3.peg.3247 putative antirepressor
cgaccgacagatagacctcgcctggcttgccgaaagcagcaagatcaacggtcagttgga
caagatgaaggcgaacatagaccatatcatccctacaggaggcaccatcaacgacaagcg
tcggtgggaggaactgtacaatatgtaccagtgtgccgtgaaagccaccaaggatgccta
tatgcccaatgcacagagaaagcggcagtatcttagcatctatgccgacctgacgacaca
gaacgagacactactgaaataccttgtgcagctcaacacccaaagccagactaccgccct
cttggcagccaccaacgaccgtgtagtacataaaggcagcatcatcagcgatgccaagag
ccgttggcaggaaaacatgaagggcgtgaggagctcgacaggcactgacggcgatgatgc
caacagcggtgagggtgaagaaagtgtgaacagatagaaataagggaagagaagaaataa
tcacaaaacagcatagagatatgaacgatattcagattttcaacaacgaggaatttggag
cagtccgaaccacaggaacaccagagcaacccttgttctgtttggctgatgtggcaagag
ttcttggactaaaaaccagcaagttggtacaacgactttcggatgatgtactttcaaagt
accccatctcggatagtcttggaagagaacaggttacaaactttatcaatgaagacggac
tgtatgatgtcatccttgacagtcgcaaacccgaagccaaacgtttccgcaagtgggtga
catcggaggtgctcccctctatccgcaagcatggtgcctatatgacacagcagaccatcg
agaaggcattggcagagccagacttcctgatacggttagcagtcaatctgaaggaagaac
gacaaaagcgtctgcttgtcgaacaggagtgtgaacaccaaaggacacgcatcgttgagt
tgggatccaaggtggatgacctgcaacaggaggtgacggagatgaaggacaaggtgagtt
accttgacatcatccttgccacgaagagcagtgtcctggtcacacagatagcacaggact
atggcgagtcgtccatccgcttcaaccgacgtctgaaggagatgaacatccagtatcagc
gtggcaagcagtggattctgtatgccgactacaaggactgcggttatgtgaccagcgaga
cctacctcattaaacacaaggacggtacggaggatgtgcgcatgaacaccaaatggacac
agaaaggtcgccgcttcctctatgagaaactgaagagcgtgggagtcattcctgttatcg
aaagaacataaaataaagaaatagctatggaatcaatatcaaaaatacagttacgtctct
atgccgccaagaggaaaaacggcaagtggcagttggagatgtcaaggatgccgaagcgaa
tcagcgttatcggcaggacacccatcgttgatgagcattatatgccatctgatttagagg
tagtttcaatgtcaaagcttcacaaatatgtcggaagttactacggcaagattgtgaaga
ccctcaaagaggaaggcatcatcaccaaggaatatggaatgtggaaactgcgtgaagacc
ttcaggacaagggcattgcggtatatgtcacaggcaggatgcgctgcttctaccacttct
atctgtcatggacaccgaaaggcatagagtttatcaaagagattatcaacaatagaacca
ggcactgatggcagacaacatactcagcgatttcggcatcaacatcctcgaagaggagat
tgacgatgtgatattccagaccaacgagttc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search