The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|452948.4.peg.2055: Staphylococcus aureus 930918-3

This feature in The SEED Viewer

NCBI Taxonomy Id: 452948

Current Assignment: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
Translate Function Assignments



Context on contig NZ_ABFA01000040 from base 843 to 11650 (10808 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2049 843 1802 960 +       3: 3 6 4   Heme ABC type transporter HtsABC, heme-binding protein locus|SA930_1095, protein_id|ZP_06025003.1, gi|262052817
2050 1964 1848 117 - 45         FIG01108070: hypothetical protein locus|SA930_1116, protein_id|ZP_06025024.1, gi|262052838
2051 2258 2043 216 - 78         FIG01108199: hypothetical protein locus|SA930_1104, protein_id|ZP_06025012.1, gi|262052826
2052 2423 2974 552 + 164         Acetyltransferase (GNAT family) SAS0976 locus|SA930_1096, protein_id|ZP_06025004.1, gi|262052818
2053 3964 3026 939 - 51 11 2: 2 1   1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) locus|SA930_1105, protein_id|ZP_06025013.1, gi|262052827
2054 4146 5507 1362 + 181 17 2: 2 1   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|SA930_1097, protein_id|ZP_06025005.1, gi|262052819
2055 5494 7167 1674 + -14   2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|menD, locus|SA930_1098, protein_id|ZP_06025006.1, gi|262052820
2056 7154 7957 804 + -14 18 2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|SA930_1099, protein_id|ZP_06025007.1, gi|262052821
2057 7950 8771 822 + -8 22 2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|menB, locus|SA930_1100, protein_id|ZP_06025008.1, gi|262052822
2058 9339 9010 330 - 238         Staphostatin B gene_name|sspC, locus|SA930_1106, protein_id|ZP_06025014.1, gi|262052828
2059 10558 9377 1182 - 37         Staphopain B precursor (EC 3.4.22.-)  
2060 11650 10640 1011 - 81     1: 5   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Menaquinone_and_Phylloquinone_Biosynthesis OlgaZ 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
Menaquinone_biosynthesis_PanGenomes Smajic_Semra_user 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)


  Protein Sequence

>fig|452948.4.peg.2055 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
MGNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHPNIKTWIHPDERSAA
FFAVGLIKGSERPVAILCTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQA
INQVNMFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLT
PDLNATELLTSEMKILPHYQKSIDASALRHILNKKKGLIIVGDMQHQEVDQILTYSTIYD
LPILADPLSHLRKFDHPNVICTYDLLFRSGLDLNVDFVIRVGKPVISKKLNQWLKKTDAF
QILVQNNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVSWLEKWQCLEKKGRKEIKC
YLEQATDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIV
STALGMAVHKRITLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESA
TDYFERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNFK
QHQILYQKLSEMIHDTL

MD5 = c8de85fdad88a29b983407f4ccae7fce


  DNA Sequence

>fig|452948.4.peg.2055 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
atgggaaatcataaagcagctttaacgaagcaagtttttacatttgcatctgagttatat
gcgtacggcgtaagggaagtagttatcagtccgggatcacgctcaacgccacttgcactt
gcatttgaagcacatccaaatattaaaacatggatacaccccgatgagcgaagtgcagcg
ttttttgcagttgggttaattaaaggcagtgaaagacctgtcgctatattatgtacgtca
ggtacagcagcagcgaattatacgcctgcaattgctgaaagccaaattagtagaattcct
ttaatcgttttaacaagtgaccgtccgcatgaattaagaagtgtaggcgcaccacaagcg
attaatcaagtaaatatgtttaataattatgtaagttatgagttcgatatgcctattgcg
gatgatagtaaagagaccattgatgcaatttactatcaaatgcaaattgctagtcaatat
ttatatggaccacataaagggccaattcattttaacttgccatttagagatccgttaaca
cctgatttgaatgcaacagaattgttaacttctgagatgaagattttaccgcactatcaa
aaaagtatagatgcatcggcattaagacacattttaaataagaaaaaaggtttaattatt
gtaggggatatgcagcaccaagaagttgatcaaatactaacgtattcaacgatatatgat
ttgcctattttagctgatcctttaagtcatttaagaaaatttgatcatccgaatgttatc
tgtacatatgatttgctgtttagaagcggcttagacttaaatgtggatttcgtaattcgt
gttgggaaaccagtgatttctaaaaagttaaatcaatggttaaagaaaactgatgcattt
caaatattagtgcaaaacaatgataagattgatgtctttccgatagcgccagatatttca
tatgagatttctgcgaatgatttctttaggtcattaatggaagacacgacagttaatcgc
gtaagttggttagaaaaatggcaatgcttagagaaaaaagggcgtaaagaaattaaatgt
tatttggaacaagctacagatgagagtgcattcgttggtgaattgattaagaaaacatct
gaaaaagatgcattatttattagtaatagtatgcctatcagagatgtagataacttgtta
ttgaataaaaatatagatgtctatgcgaatcgtggtgcgaatggtattgatggtatcgtt
tcaactgcactgggtatggctgtgcataaacgaataacattattgataggtgatttatca
ttttatcatgatatgaatggactattaatgtcaaaattaaataatattcagatgaatatt
gtattattgaacaacgatggtggcggtattttttcatatttaccacaaaaagaaagtgca
actgactattttgaacggttgtttggcacaccgacgggattggatttcgagtatacagct
aagttatatcaattcgattttaaacgttttaacagtgtttcagaatttaaaaatgccaca
ttgttatctgaaacttcgacgatttatgaattgataacgaatcgcgaagataactttaaa
cagcatcaaattttataccagaaattgagtgaaatgattcatgacacattataa


  DNA with Flanking Sequence

>fig|452948.4.peg.2055 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
tacaaaaaatgttgaagcatttttaaaagataataaaaacttaatcgaacatcgatttgt
tgttgacagtattttacatgatattaaaccttatatcactgaattacattatgataagac
gcctaaaattctaaaaaatgatcatttatatcacttgtacactgaaataaaggcgccact
gaaggatgattcgtatattagtttaattgataatttacatccaacacctgctttaggtgg
ctatccaaaagaatttgcaatggattttattgagcagaaagaatttggtacgcgaggatt
atatggtgcaccggttggctatatagatatatacgatgattgtgaatttattgttgcaat
tcgttcgatgcttattaagaaagcacaagcaactttatttgctgggtgtggcattgttaa
agattctgatccagatagtgaattggcagaaacgaaccttaagttcacacctatgatgaa
tgcattaggagtcgatatgaatgggaaatcataaagcagctttaacgaagcaagttttta
catttgcatctgagttatatgcgtacggcgtaagggaagtagttatcagtccgggatcac
gctcaacgccacttgcacttgcatttgaagcacatccaaatattaaaacatggatacacc
ccgatgagcgaagtgcagcgttttttgcagttgggttaattaaaggcagtgaaagacctg
tcgctatattatgtacgtcaggtacagcagcagcgaattatacgcctgcaattgctgaaa
gccaaattagtagaattcctttaatcgttttaacaagtgaccgtccgcatgaattaagaa
gtgtaggcgcaccacaagcgattaatcaagtaaatatgtttaataattatgtaagttatg
agttcgatatgcctattgcggatgatagtaaagagaccattgatgcaatttactatcaaa
tgcaaattgctagtcaatatttatatggaccacataaagggccaattcattttaacttgc
catttagagatccgttaacacctgatttgaatgcaacagaattgttaacttctgagatga
agattttaccgcactatcaaaaaagtatagatgcatcggcattaagacacattttaaata
agaaaaaaggtttaattattgtaggggatatgcagcaccaagaagttgatcaaatactaa
cgtattcaacgatatatgatttgcctattttagctgatcctttaagtcatttaagaaaat
ttgatcatccgaatgttatctgtacatatgatttgctgtttagaagcggcttagacttaa
atgtggatttcgtaattcgtgttgggaaaccagtgatttctaaaaagttaaatcaatggt
taaagaaaactgatgcatttcaaatattagtgcaaaacaatgataagattgatgtctttc
cgatagcgccagatatttcatatgagatttctgcgaatgatttctttaggtcattaatgg
aagacacgacagttaatcgcgtaagttggttagaaaaatggcaatgcttagagaaaaaag
ggcgtaaagaaattaaatgttatttggaacaagctacagatgagagtgcattcgttggtg
aattgattaagaaaacatctgaaaaagatgcattatttattagtaatagtatgcctatca
gagatgtagataacttgttattgaataaaaatatagatgtctatgcgaatcgtggtgcga
atggtattgatggtatcgtttcaactgcactgggtatggctgtgcataaacgaataacat
tattgataggtgatttatcattttatcatgatatgaatggactattaatgtcaaaattaa
ataatattcagatgaatattgtattattgaacaacgatggtggcggtattttttcatatt
taccacaaaaagaaagtgcaactgactattttgaacggttgtttggcacaccgacgggat
tggatttcgagtatacagctaagttatatcaattcgattttaaacgttttaacagtgttt
cagaatttaaaaatgccacattgttatctgaaacttcgacgatttatgaattgataacga
atcgcgaagataactttaaacagcatcaaattttataccagaaattgagtgaaatgattc
atgacacattataaattttatgaagcaaacgttgagaccaatcaagttttagtatttctg
catggatttcttagcgacagccgtacttatcataatcacatcgaaaaatttactgataac
tatcatgtcatcactatagacttaccaggccatggcgaagatcagtcttcaatggatgaa
acgtggaattttgattatattacgacgttgttagaccgaattttagataaatataaagat
aaatcaataacattgtttggatattcaatgggtgggcgtgttgcattatattatgcaatt
aatggtcacatccctatatctaatttgatattagaaagtacgtcaccaggtattaaagaa
gaagcaaatcaattggaacgccgtcttgttgatgatgcacgtgctaaagtattagacata
gcaggtattgaattatttgttaatgattgggaaaagttgccattatttcaatcgcaacta
gaattaccagttgaaatacaacatcaaataagac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000287       F:magnesium ion binding
GO:0008683       F:2-oxoglutarate decarboxylase activity
GO:0009234       P:menaquinone biosynthetic process
GO:0030145       F:manganese ion binding
GO:0030976       F:thiamin pyrophosphate binding
GO:0070204       F:2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh...
cmr|NT05SA0891 Staphylococcus aureus NCTC 8325     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
cmr|SACOL1052 Staphylococcus aureus subsp. aureus COL     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
cmr|SAUSA300_0946 Staphylococcus aureus subsp. aureus USA300-FPR3757     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
dbj|BAF67185.1 Staphylococcus aureus subsp. aureus str. Newman     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
fig|367830.3.peg.1511 Staphylococcus aureus subsp. aureus USA300 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|426430.6.peg.883 Staphylococcus aureus subsp. aureus str. Newman FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|426430.8.peg.987 Staphylococcus aureus subsp. aureus str. Newman FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|451515.3.peg.1039 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|451516.9.peg.1043 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|455227.3.peg.1403 Staphylococcus aureus D30 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|546342.3.peg.1013 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|546343.3.peg.1880 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|548474.3.peg.1273 Staphylococcus aureus subsp. aureus TCH130 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|553567.3.peg.1506 Staphylococcus aureus A5948 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|553590.4.peg.87 Staphylococcus aureus A9754 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|553594.3.peg.2026 Staphylococcus aureus A9765 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|644279.4.peg.1048 Staphylococcus aureus subsp. aureus 132 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|93061.3.peg.945 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|93061.5.peg.903 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|93062.19.peg.1023 Staphylococcus aureus subsp. aureus COL FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
fig|93062.4.peg.1221 Staphylococcus aureus subsp. aureus COL FIG   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
gb|AAW36517.1 Staphylococcus aureus subsp. aureus COL     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gb|ABD22875.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gb|ABD30108.1 Staphylococcus aureus subsp. aureus NCTC 8325     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gb|ABX29011.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     2-oxoglutarate decarboxylase
gb|EES98103.1 Staphylococcus aureus subsp. aureus TCH130     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gb|EEV83054.1 Staphylococcus aureus A5948     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gb|EEW44326.1 Staphylococcus aureus 930918-3     menaquinone biosynthesis protein
gb|EEW47064.1 Staphylococcus aureus D30     menaquinone biosynthesis protein
gi|122539837 organism not parsed/found in ncbi nr NCBI   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
gi|123486474 organism not parsed/found in ncbi nr NCBI   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
gi|150373925 Staphylococcus aureus subsp. aureus str. Newman NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
gi|151221125 Staphylococcus aureus subsp. aureus str. Newman NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
gi|160368040 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   2-oxoglutarate decarboxylase
gi|161509231 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   2-oxoglutarate decarboxylase
gi|193806123 organism not parsed/found in ncbi nr NCBI   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
gi|193806124 organism not parsed/found in ncbi nr NCBI   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
gi|221138021 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   2-oxoglutarate decarboxylase
gi|221141827 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   2-oxoglutarate decarboxylase
gi|253729374 Staphylococcus aureus subsp. aureus TCH130 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|253732596 Staphylococcus aureus subsp. aureus TCH130 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|257860222 Staphylococcus aureus A5948 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|258452007 Staphylococcus aureus A5948 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|259159268 Staphylococcus aureus 930918-3 NCBI   menaquinone biosynthesis protein
gi|259162495 Staphylococcus aureus D30 NCBI   menaquinone biosynthesis protein
gi|57284423 Staphylococcus aureus subsp. aureus COL NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|57650237 Staphylococcus aureus subsp. aureus COL NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|81694793 organism not parsed/found in ncbi nr NCBI   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
gi|87128361 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|87162387 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|87202298 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
gi|88194740 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
img|637151816 Staphylococcus aureus aureus COL IMG   2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase( EC:4.1.1.71 )
img|637887598 Staphylococcus aureus aureus USA300 IMG   2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase( EC:4.1.1.71 )
img|637893629 Staphylococcus aureus aureus NCTC 8325 IMG   2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase( EC:4.1.1.71 )
img|640795293 Staphylococcus aureus aureus Newman IMG   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
img|641308961 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   2-oxoglutarate decarboxylase( EC:4.1.1.71 )
kegg|saa:SAUSA300_0946 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase (EC:4.1.1.71)
kegg|sac:SACOL1052 Staphylococcus aureus subsp. aureus COL KEGG   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase (EC:4.1.1.71)
kegg|sae:NWMN_0913 Staphylococcus aureus subsp. aureus Newman KEGG   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase
kegg|sao:SAOUHSC_00983 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase (EC:4.1.1.71)
kegg|sax:USA300HOU_0991 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   2-oxoglutarate decarboxylase (EC:4.1.1.71)
ref|YP_001331947.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase
ref|YP_001574890.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   2-oxoglutarate decarboxylase
ref|YP_185917.1 Staphylococcus aureus subsp. aureus COL RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
ref|YP_493644.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
ref|YP_499536.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
ref|ZP_03562823.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   2-oxoglutarate decarboxylase
ref|ZP_03566320.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   2-oxoglutarate decarboxylase
ref|ZP_04866761.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
ref|ZP_05700023.1 Staphylococcus aureus A5948 RefSeq   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
sp|A6QFQ3 Staphylococcus aureus (strain Newman) SwissProt   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
sp|A8Z0D7 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
sp|MEND_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
sp|MEND_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
sp|MEND_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
sp|MEND_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
sp|MEND_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Short=SEPHCHC synthase; AltName: Full=Menaquinone biosynthesis protein menD
sp|Q2FI34 Staphylococcus aureus (strain USA300) SwissProt   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
sp|Q2FZL7 Staphylococcus aureus (strain NCTC 8325) SwissProt   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
sp|Q5HH40 Staphylococcus aureus (strain COL) SwissProt   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
tr|C5PY01 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
11 fig|452948.4.peg.2053 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)
17 fig|452948.4.peg.2054 Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2)
18 fig|452948.4.peg.2056 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
22 fig|452948.4.peg.2057 Naphthoate synthase (EC 4.1.3.36)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search