The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451707.4.peg.5565: Bacillus cereus NVH0597-99

This feature in The SEED Viewer

NCBI Taxonomy Id: 451707

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_ABDK02000071 from base 2598 to 14024 (11427 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5556 3239 2598 642 -           hypothetical protein locus|BC059799_B0004, protein_id|ZP_03109728.1, gi|196042487
5557 4019 3360 660 - 120         LPXTG-site transpeptidase family protein locus|BC059799_B0005, protein_id|ZP_03109732.1, gi|196042491
5558 4618 4076 543 - 56         FIG01228682: hypothetical protein locus|BC059799_B0006, protein_id|ZP_03109734.1, gi|196042493
5559 4762 4881 120 + 143         hypothetical protein locus|BC059799_B0008, protein_id|ZP_03109708.1, gi|196042467
5560 5719 6849 1131 + 837         Prophage helix-turn-helix protein locus|BC059799_B0009, protein_id|ZP_03109713.1, gi|196042472
5561 6890 7042 153 + 40         hypothetical protein locus|BC059799_B0010, protein_id|ZP_03109745.1, gi|196042504
5562 7200 7334 135 + 157         hypothetical protein locus|BC059799_B0011, protein_id|ZP_03109776.1, gi|196042535
5563 7702 7361 342 - 26         prophage LambdaBa04, DNA-binding protein locus|BC059799_B0012, protein_id|ZP_03109780.1, gi|196042539
5564 7877 8098 222 + 174         prophage LambdaBa04, DNA-binding protein locus|BC059799_B0013, protein_id|ZP_03109768.1, gi|196042527
5565 8116 8889 774 + 17         Phage antirepressor protein locus|BC059799_B0014, protein_id|ZP_03109769.1, gi|196042528
5566 8890 9012 123 + 0         hypothetical protein locus|BC059799_B0015, protein_id|ZP_03109720.1, gi|196042479
5567 9002 9142 141 + -11         hypothetical protein locus|BC059799_B0016, protein_id|ZP_03109727.1, gi|196042486
5568 9492 9668 177 + 349         FIG01237555: hypothetical protein locus|BC059799_B0017, protein_id|ZP_03109743.1, gi|196042502
5569 9686 10702 1017 + 17         prophage LambdaBa04, DnaD replication protein, putative locus|BC059799_B0018, protein_id|ZP_03109756.1, gi|196042515
5570 10695 11504 810 + -8     1: 1   DNA replication protein DnaC locus|BC059799_B0019, protein_id|ZP_03109704.1, gi|196042463
5571 11494 11967 474 + -11         FIG01233172: hypothetical protein locus|BC059799_B0020, protein_id|ZP_03109783.1, gi|196042542
5572 11954 12145 192 + -14         FIG01230187: hypothetical protein locus|BC059799_B0021, protein_id|ZP_03109761.1, gi|196042520
5573 12142 12423 282 + -4         Phage protein locus|BC059799_B0022, protein_id|ZP_03109777.1, gi|196042536
5574 12439 12756 318 + 15         hypothetical protein locus|BC059799_B0023, protein_id|ZP_03109718.1, gi|196042477
5575 12771 13223 453 + 14         hypothetical protein  
5576 13220 13636 417 + -4         FIG01250823: hypothetical protein locus|BC059799_B0025, protein_id|ZP_03109788.1, gi|196042547
5577 13645 13788 144 + 8         FIG01228083: hypothetical protein locus|BC059799_B0026, protein_id|ZP_03109770.1, gi|196042529
5578 13769 13891 123 + -20         hypothetical protein locus|BC059799_B0027, protein_id|ZP_03109746.1, gi|196042505
5579 13857 14024 168 + -35         hypothetical protein locus|BC059799_B0028, protein_id|ZP_03109775.1, gi|196042534

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451707.4.peg.5565 Phage antirepressor protein
MNQLQNFSHGTFGKLEILMKDGKEYFPATYVANLLGYANATEAIKRHCKNEGVAFHEVPT
TSGVQNKKFINEPNLYRLIVKSKLPQAEHFEKWVFEEVLPSIRKHGAYMTDQVLEQAVTN
PDFMIGLLTNLKEEKAKRVEAERTILQQQPLVTFAEAVQVSTNLITVKQLANLMRQKGID
TGQNRLFEWFRENGYLCKKKGSLYNTPTQYSMDLELFESQEYVRTNSQGEFVTSFTTKVT
GKGQLYFINKFLGKEAV

MD5 = 5038421fd0e512a5deb37d11a3be0a10


  DNA Sequence

>fig|451707.4.peg.5565 Phage antirepressor protein
atgaatcaattacaaaatttttcacacggtacgttcggtaaattagaaattcttatgaaa
gatggaaaagaatacttcccagcaacatacgtcgctaacttactaggatacgcaaatgct
acagaagcaataaagcgtcactgtaaaaatgagggggtcgcgtttcacgaggtcccaact
acgagcggtgttcaaaataaaaaattcatcaatgaacccaatttataccgcttgatagta
aaatcgaaacttccacaagcggaacattttgaaaaatgggtattcgaagaagtgcttcct
tctattagaaaacacggagcatacatgacagatcaagtcctggaacaagcggtaacaaac
ccagacttcatgattggacttcttacaaacttaaaagaagagaaagcaaaacgagttgaa
gcggaacgaacaatcttacaacaacagccacttgtaacgtttgctgaagcggtgcaagta
tcaacaaacctaataaccgtcaaacagttagctaacttaatgagacaaaaaggaatcgat
acaggtcaaaacagactcttcgaatggttcagagaaaacggatacctttgcaagaagaaa
ggcagtctttacaacacgccgacacagtattcaatggatttagagttatttgaatcacaa
gaatatgtaagaacaaatagccaaggtgagtttgtaacatcattcactacaaaagttaca
gggaaaggtcagctttacttcattaataagtttctcggaaaggaagcagtttaa


  DNA with Flanking Sequence

>fig|451707.4.peg.5565 Phage antirepressor protein
tgttgctcttgatatgtttaacaggttagctacatcgccttgtgtgcgcttgcccctcag
ttgttttagtttttctccaaaagtcattttaaattttcccctctcagtaaatccttaatt
acattatagatacaaattttatcactttaaacccctttttagaaaaacgataaaaaattt
ataaaatctgttgacgataaaaaatttatcatttatactgaagtcaacaaagaaacgcga
gttgaaatggaaggtggttaaatgaataacatcttaagaatcgaaagaaaaaagatgaaa
ttcacacaaaagcaattagctgaaaagattggtatatcaactgtttacgttcgcaagatt
gagagtggatatataccgagaccagatataatggttaagtatcaggaggtatttgacata
agtgttaaagagctatttcctgattatttttcggtatttagtgataagaaatttatcatt
tgaataagggaggaaagaaaatgaatcaattacaaaatttttcacacggtacgttcggta
aattagaaattcttatgaaagatggaaaagaatacttcccagcaacatacgtcgctaact
tactaggatacgcaaatgctacagaagcaataaagcgtcactgtaaaaatgagggggtcg
cgtttcacgaggtcccaactacgagcggtgttcaaaataaaaaattcatcaatgaaccca
atttataccgcttgatagtaaaatcgaaacttccacaagcggaacattttgaaaaatggg
tattcgaagaagtgcttccttctattagaaaacacggagcatacatgacagatcaagtcc
tggaacaagcggtaacaaacccagacttcatgattggacttcttacaaacttaaaagaag
agaaagcaaaacgagttgaagcggaacgaacaatcttacaacaacagccacttgtaacgt
ttgctgaagcggtgcaagtatcaacaaacctaataaccgtcaaacagttagctaacttaa
tgagacaaaaaggaatcgatacaggtcaaaacagactcttcgaatggttcagagaaaacg
gatacctttgcaagaagaaaggcagtctttacaacacgccgacacagtattcaatggatt
tagagttatttgaatcacaagaatatgtaagaacaaatagccaaggtgagtttgtaacat
cattcactacaaaagttacagggaaaggtcagctttacttcattaataagtttctcggaa
aggaagcagtttaaatgatggaagaaagcacattatcactaggaatcgtagcagcggcaa
tatgtgtattcgtatacctggtacatcgaattgatgttgtagcaaagagagcaggatggc
ttgaagatgacaaataaagaacagcgtgatgaatacgaacaaaagaaactagcatggatc
ataaaagatttacgagctagagggatacataacagcgcagataaggttgaggaaatgcat
aaggagtttataactctagctaaataataaaagccctacatgttgaggtgcagggcgata
aaaagatagtagttttagatttcggaaaaaagaaatcttgaggtgtaattagcttaacac
acaatttattaaaactctatataaagattttatgaaaataggaatatagacaagccttcg
cttgtaggaatattcaggaatctaatggtatcccccacctagtgaatgggttcctgggta
ttccaatgcgtgaaagcatcaaaacaaaataaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EDX65351.1 Bacillus cereus NVH0597-99     antirepressor, phage associated
gi|196026685 Bacillus cereus NVH0597-99 NCBI   antirepressor, phage associated
gi|196042528 Bacillus cereus NVH0597-99 NCBI   antirepressor, phage associated
img|642062092 Bacillus cereus NVH0597-99 IMG   antirepressor, phage associated protein
ref|ZP_03109769.1 Bacillus cereus NVH0597-99 RefSeq   antirepressor, phage associated
tr|B3ZH34 Bacillus cereus NVH0597-99 TrEMBL   Antirepressor, phage associated


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search