The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2456: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: TetR family regulatory protein of MDR cluster
Translate Function Assignments



Context on contig NC_007793 from base 2467214 to 2477963 (10750 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2451 2467214 2467633 420 +           FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 4   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625
2453 2468869 2469507 639 + 270         FIG01108339: hypothetical protein locus|SAUSA300_2297, protein_id|YP_494932.1, gi|87162144, geneID|3914691
2454 2471684 2469753 1932 - 245     1: 1   Membrane component of multidrug resistance system locus|SAUSA300_2298, protein_id|YP_494933.1, gi|87161734, geneID|3913020
2455 2472344 2471697 648 - 12     1: 1   Multidrug resistance protein [function not yet clear] locus|SAUSA300_2299, protein_id|YP_494934.1, gi|87160414, geneID|3913132
2456 2472465 2473016 552 + 120     1: 1   TetR family regulatory protein of MDR cluster locus|SAUSA300_2300, protein_id|YP_494935.1, gi|87162322, geneID|3913456
2457 2474454 2473246 1209 - 229     1: 2 dlit(11042376) Teicoplanin resistance transporter, TcaB family => TcaB gene_name|tcaB, locus|SAUSA300_2301, protein_id|YP_494936.1, gi|87161925, geneID|3914585
2458 2476105 2474723 1383 - 268     1: 2   Teicoplanin resistance associated membrane protein TcaA gene_name|tcaA, locus|SAUSA300_2302, protein_id|YP_494937.1, gi|87161173, geneID|3914747
2459 2476800 2476345 456 - 239     2: 2 3 dlit(11042376)
dlit(15060048)
Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR gene_name|tcaR, locus|SAUSA300_2303, protein_id|YP_494938.1, gi|87159885, geneID|3914106
2460 2476995 2477963 969 + 194         Integral membrane protein locus|SAUSA300_2304, protein_id|YP_494939.1, gi|87162083, geneID|3914626

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Multidrug_Resistance,_2-protein_version_Found_in_Gram-positive_bacteria RossO TetR family regulatory protein of MDR cluster


  Protein Sequence

>fig|451515.3.peg.2456 TetR family regulatory protein of MDR cluster
MKRQAKIEIQNALVDLMAEYPFQEISTKMICAYCNINRSTFYDYYKDKFDLLDTINSKHK
EKFQFLLSALHHNFENIKQDKLKLYKFFIIIAKYIKHNEQFFKDILVTYPMKTLFIDYIN
LARDYYQQIMNDYSTTVTNKQLYVTYIIGGQAGVFINWLSNGCNESPEEVADILLANTIK
LQN

MD5 = 21f90bc5ff4d2057870406b9f4b2d7ed


  DNA Sequence

>fig|451515.3.peg.2456 TetR family regulatory protein of MDR cluster
atgaaacgacaagccaaaatagaaattcaaaacgcacttgttgatttgatggctgaatat
ccttttcaagaaatatccactaaaatgatttgcgcgtattgtaatattaatcgttctact
ttttatgattattacaaagataaatttgatttattggataccatcaactcaaagcataag
gaaaaattccaatttcttctaagcgcgctacatcataatttcgaaaatattaaacaggat
aagcttaaactttataaattcttcattattattgctaagtatatcaagcacaatgagcag
tttttcaaagacattttagttacctatccaatgaaaacattattcatagactatataaat
ttagcgagagattactatcaacaaattatgaatgactatagtactacagtaaccaataaa
cagctttatgttacatatatcataggcggtcaagctggggtgtttattaattggctttcg
aatggttgtaatgaatcacctgaagaagttgctgacattttattggctaatacgattaaa
cttcaaaactaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2456 TetR family regulatory protein of MDR cluster
gctgttacatataaatcatctaaattgtatgcataagcgattgggttaccagcttgcacc
attgaaccttccataccatctaatttggcaattgtacctttttgaggcattttaagatcc
atatctttcgtttcgccatcttgaccttgtacagtaacaattgctactttgtcaccttta
tcgagtttgtcaccttgtttaacattaagtgatttaatttgtccagatgcaggacttgct
attttaatttgatcgccatttacttttgcattatcagttgttacatagcttgttgtttta
ttccaaaaataaaagccagcaatcccaattgctaacagtacaacaaccgtaatgacatta
attaatatcatctttttcatgaaacatttcctcctatttgcttttaaaattcactttatt
tattatagagacatgataactaaaaaaacaccaacaatttttataagagtgttggttaaa
attcacaaaggtgtaacaatatgaaacgacaagccaaaatagaaattcaaaacgcacttg
ttgatttgatggctgaatatccttttcaagaaatatccactaaaatgatttgcgcgtatt
gtaatattaatcgttctactttttatgattattacaaagataaatttgatttattggata
ccatcaactcaaagcataaggaaaaattccaatttcttctaagcgcgctacatcataatt
tcgaaaatattaaacaggataagcttaaactttataaattcttcattattattgctaagt
atatcaagcacaatgagcagtttttcaaagacattttagttacctatccaatgaaaacat
tattcatagactatataaatttagcgagagattactatcaacaaattatgaatgactata
gtactacagtaaccaataaacagctttatgttacatatatcataggcggtcaagctgggg
tgtttattaattggctttcgaatggttgtaatgaatcacctgaagaagttgctgacattt
tattggctaatacgattaaacttcaaaactaataatacggtttcattctaataaagaaat
gctataaaacaactagataaagttaaaccaaatggatagataatagtacatatgtaacgg
tgctatcaatataaaaatgccgagatttccacataataatctcggcatttttatttttga
tgctaaattcataggtctatgaatagctcaagttttgttttttaatttttcaattcaata
taatagaagaaactatgtttatcatcgatttgttttaaataccttcatattataaatctg
taaaataattaatataactgctgtagctataataataattatgtaaggtataggattatc
ttcaccttttacccccactaatggcgatgcaacaccaccaaataaaaactgtactaaacc
taataaacttgatgaactccctctaccactactactttcatccatagctattgtaaaacc
aagtgtcgcaacacctgtcactggtgctattaaaatgataaatcctatcgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
cmr|NT03SA2450 Staphylococcus aureus MW2     transcriptional regulator, tetR family
cmr|NT05SA2370 Staphylococcus aureus NCTC 8325     regulatory protein TetR family
cmr|NT09SA2256 Staphylococcus aureus subsp. aureus MSSA476     transcriptional regulator, TetR family, putative
cmr|SACOL2349 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, TetR family
cmr|SAUSA300_2300 Staphylococcus aureus subsp. aureus USA300-FPR3757     transcriptional regulator, TetR family
dbj|BAB96140.1 Staphylococcus aureus subsp. aureus MW2     MW2275
dbj|BAF68527.1 Staphylococcus aureus subsp. aureus str. Newman     transcriptional regulator TetR family protein
emb|CAG44058.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   TetR family regulatory protein
fig|196620.1.peg.2275 Staphylococcus aureus subsp. aureus MW2 FIG   TetR family regulatory protein of MDR cluster
fig|196620.5.peg.2352 Staphylococcus aureus subsp. aureus MW2 FIG   TetR family regulatory protein of MDR cluster
fig|282459.1.peg.2224 Staphylococcus aureus subsp. aureus MSSA476 FIG   TetR family regulatory protein of MDR cluster
fig|282459.5.peg.2335 Staphylococcus aureus subsp. aureus MSSA476 FIG   TetR family regulatory protein of MDR cluster
fig|367830.3.peg.2587 Staphylococcus aureus subsp. aureus USA300 FIG   TetR family regulatory protein of MDR cluster
fig|426430.6.peg.2184 Staphylococcus aureus subsp. aureus str. Newman FIG   TetR family regulatory protein of MDR cluster
fig|426430.8.peg.2453 Staphylococcus aureus subsp. aureus str. Newman FIG   TetR family regulatory protein of MDR cluster
fig|450394.6.peg.1855 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   TetR family regulatory protein of MDR cluster
fig|451516.9.peg.2445 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   TetR family regulatory protein of MDR cluster
fig|452948.4.peg.1203 Staphylococcus aureus 930918-3 FIG   TetR family regulatory protein of MDR cluster
fig|455227.3.peg.1837 Staphylococcus aureus D30 FIG   TetR family regulatory protein of MDR cluster
fig|546342.3.peg.1028 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   TetR family regulatory protein of MDR cluster
fig|546343.3.peg.1317 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   TetR family regulatory protein of MDR cluster
fig|548474.3.peg.522 Staphylococcus aureus subsp. aureus TCH130 FIG   TetR family regulatory protein of MDR cluster
fig|548475.3.peg.1815 Staphylococcus aureus subsp. aureus TCH70 FIG   TetR family regulatory protein of MDR cluster
fig|553567.3.peg.2131 Staphylococcus aureus A5948 FIG   TetR family regulatory protein of MDR cluster
fig|553590.4.peg.959 Staphylococcus aureus A9754 FIG   TetR family regulatory protein of MDR cluster
fig|553594.3.peg.2112 Staphylococcus aureus A9765 FIG   TetR family regulatory protein of MDR cluster
fig|644279.4.peg.2497 Staphylococcus aureus subsp. aureus 132 FIG   TetR family regulatory protein of MDR cluster
fig|762962.3.peg.2155 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   TetR family regulatory protein of MDR cluster
fig|93061.3.peg.2484 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   TetR family regulatory protein of MDR cluster
fig|93061.5.peg.2380 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   TetR family regulatory protein of MDR cluster
fig|93062.19.peg.2295 Staphylococcus aureus subsp. aureus COL FIG   TetR family regulatory protein of MDR cluster
fig|93062.4.peg.2409 Staphylococcus aureus subsp. aureus COL FIG   TetR family regulatory protein of MDR cluster
gb|AAW37177.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, TetR family
gb|ABD22810.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     transcriptional regulator, TetR family
gb|ABD31640.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30328.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     TetR family transcriptional regulator
gb|EES56054.1 Staphylococcus aureus subsp. aureus TCH70     TetR family transcriptional regulator
gb|EES94967.1 Staphylococcus aureus subsp. aureus USA300_TCH959     TetR family transcriptional regulator
gb|EES96655.1 Staphylococcus aureus subsp. aureus TCH130     TetR family transcriptional regulator
gb|EEV82543.1 Staphylococcus aureus A5948     transcriptional regulator TetR family protein
gi|150375267 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator TetR family protein
gi|151222467 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator TetR family protein
gi|160369357 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   TetR family transcriptional regulator
gi|161510548 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   TetR family transcriptional regulator
gi|21205447 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2275
gi|21284004 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2275
gi|221138036 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   TetR family transcriptional regulator
gi|221141287 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   TetR family transcriptional regulator
gi|251803397 Staphylococcus aureus subsp. aureus TCH70 NCBI   TetR family transcriptional regulator
gi|251813214 Staphylococcus aureus subsp. aureus TCH70 NCBI   TetR family transcriptional regulator
gi|253726238 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   TetR family transcriptional regulator
gi|253727926 Staphylococcus aureus subsp. aureus TCH130 NCBI   TetR family transcriptional regulator
gi|253730025 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   TetR family transcriptional regulator
gi|253734231 Staphylococcus aureus subsp. aureus TCH130 NCBI   TetR family transcriptional regulator
gi|257859699 Staphylococcus aureus A5948 NCBI   transcriptional regulator TetR family protein
gi|258452627 Staphylococcus aureus A5948 NCBI   transcriptional regulator TetR family protein
gi|49245580 Staphylococcus aureus subsp. aureus MSSA476 NCBI   TetR family regulatory protein
gi|49487137 Staphylococcus aureus subsp. aureus MSSA476 NCBI   TetR family regulatory protein
gi|57285083 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator, TetR family
gi|57650897 Staphylococcus aureus subsp. aureus COL NCBI   TetR family transcriptional regulator
gi|87128296 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcriptional regulator, TetR family
gi|87162322 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   TetR family transcriptional regulator
gi|87203830 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196272 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02631
img|637153108 Staphylococcus aureus aureus COL IMG   transcriptional regulator, TetR family
img|637158515 Staphylococcus aureus aureus MSSA476 IMG   TetR family regulatory protein
img|637300092 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888943 Staphylococcus aureus aureus USA300 IMG   transcriptional regulator, TetR family
img|637895241 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796686 Staphylococcus aureus aureus Newman IMG   transcriptional regulator TetR family protein
img|641310342 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   TetR family transcriptional regulator
img|641773184 Staphylococcus aureus aureus USA300_TCH959 IMG   TetR family transcriptional regulator
kegg|saa:SAUSA300_2300 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   TetR family transcriptional regulator
kegg|sac:SACOL2349 Staphylococcus aureus subsp. aureus COL KEGG   TetR family transcriptional regulator
kegg|sae:NWMN_2255 Staphylococcus aureus subsp. aureus Newman KEGG   transcriptional regulator TetR family protein
kegg|sam:MW2275 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02631 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2245   KEGG   TetR family regulatory protein
kegg|sax:USA300HOU_2336 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   TetR family transcriptional regulator
ref|NP_647092.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2275
ref|YP_001333289.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   transcriptional regulator TetR family protein
ref|YP_001576207.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   TetR family transcriptional regulator
ref|YP_044358.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   TetR family regulatory protein
ref|YP_187155.1 Staphylococcus aureus subsp. aureus COL RefSeq   TetR family transcriptional regulator
ref|YP_494935.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   TetR family transcriptional regulator
ref|YP_501092.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02631
ref|ZP_03562838.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   TetR family transcriptional regulator
ref|ZP_03565780.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   TetR family transcriptional regulator
ref|ZP_04827687.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   TetR family transcriptional regulator
ref|ZP_04864190.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   TetR family transcriptional regulator
ref|ZP_04868396.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   TetR family transcriptional regulator
ref|ZP_05700631.1 Staphylococcus aureus A5948 RefSeq   transcriptional regulator TetR family protein
tr|A6QJJ5 Staphylococcus aureus (strain Newman) TrEMBL   Transcriptional regulator TetR family protein
tr|A8Z545 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   TetR family transcriptional regulator
tr|C5MZP8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   TetR family transcriptional regulator
tr|C5Q2M7 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   TetR family transcriptional regulator
tr|C5QFX1 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   TetR family transcriptional regulator
tr|Q2FEE3 Staphylococcus aureus (strain USA300) TrEMBL   Transcriptional regulator, TetR family
tr|Q2G2W4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDK2 Staphylococcus aureus (strain COL) TrEMBL   Transcriptional regulator, TetR family
tr|Q6G6W6 Staphylococcus aureus (strain MSSA476) TrEMBL   TetR family regulatory protein
tr|Q8NV49 Staphylococcus aureus (strain MW2) TrEMBL   MW2275 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search