The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2453: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: FIG01108339: hypothetical protein
Translate Function Assignments



Context on contig NC_007793 from base 2463346 to 2474454 (11109 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2447 2463346 2464554 1209 +           Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 3 10 12 15   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 9   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 14 6 4 8 5 2 13   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 7   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625
2453 2468869 2469507 639 + 270         FIG01108339: hypothetical protein locus|SAUSA300_2297, protein_id|YP_494932.1, gi|87162144, geneID|3914691
2454 2471684 2469753 1932 - 245     1: 1   Membrane component of multidrug resistance system locus|SAUSA300_2298, protein_id|YP_494933.1, gi|87161734, geneID|3913020
2455 2472344 2471697 648 - 12     1: 1   Multidrug resistance protein [function not yet clear] locus|SAUSA300_2299, protein_id|YP_494934.1, gi|87160414, geneID|3913132
2456 2472465 2473016 552 + 120     1: 1   TetR family regulatory protein of MDR cluster locus|SAUSA300_2300, protein_id|YP_494935.1, gi|87162322, geneID|3913456
2457 2474454 2473246 1209 - 229     1: 11 dlit(11042376) Teicoplanin resistance transporter, TcaB family => TcaB gene_name|tcaB, locus|SAUSA300_2301, protein_id|YP_494936.1, gi|87161925, geneID|3914585

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2453 FIG01108339: hypothetical protein
MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK

MD5 = 168fecb6aff20a4416308f99c1616373


  DNA Sequence

>fig|451515.3.peg.2453 FIG01108339: hypothetical protein
atgacaaatccaaatcaacgattagaaccatttgatgagacatttcaacaaccgaatatt
catcgtggtaagcgatatggtaagaaaaaacgttcattggtaagcatgattattcaaatc
attgttgttatattaaccgcaatcgctggatacagcatgtggaaacaacccatttttaat
attgtcttcaccaaagaatctgtagattttgatggcattaaaaattttaacgagacaatt
ggaaaaatgcatcaattaaatattaatttgggtaatatcaatgatttacaacaaggaatc
gatcgcttaattttagtctttaacggtttctttattttatgtatcgttagcctagtcata
acaatactgacaattgtatttaatcgcacagttctaaaagtagtaaatattttagtgtta
acaattatgttagtcattacattgtatttcagttatattattaaagcactcgcacaagaa
attgcagatgttttcaaaaaatattatttaaatgtaccaccagatcaagtgattacagaa
gctgacgctattcataacggcatcattttacttggctgtagcatcggtttacttgttata
agcttattcttccgtaatcgcatgcctcgtttaaaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2453 FIG01108339: hypothetical protein
aatctccaatggaacggtgatggttgtagtgcattgaatccaccgtgaatatataaaatt
ttcttatcaatttgatgtctgaaattaaagcgaaagacttgcatatcatctaatgacaat
ttttctaaatttgctttaacatttaatgttgaaggctgcttatgtttttttctattttca
atttctcttttataaaaaaatctttcaacatcttgatcatttttaaacataatcgagcga
ttgtgaagcaaatatttattgacaacgctattcataacacggtttctaatcaatgtctta
acctacctttatatattttatgtatccaatgattgtctatcccctacattctttgccaaa
aaaagtatataatgtagaagatattttctttttcactttcaaatttaagactacaattga
acagtgatttttcatcattataacagacaactagacatattgataagtaaagaaaagaac
tttatacggaggtaccttgcatgacaaatccaaatcaacgattagaaccatttgatgaga
catttcaacaaccgaatattcatcgtggtaagcgatatggtaagaaaaaacgttcattgg
taagcatgattattcaaatcattgttgttatattaaccgcaatcgctggatacagcatgt
ggaaacaacccatttttaatattgtcttcaccaaagaatctgtagattttgatggcatta
aaaattttaacgagacaattggaaaaatgcatcaattaaatattaatttgggtaatatca
atgatttacaacaaggaatcgatcgcttaattttagtctttaacggtttctttattttat
gtatcgttagcctagtcataacaatactgacaattgtatttaatcgcacagttctaaaag
tagtaaatattttagtgttaacaattatgttagtcattacattgtatttcagttatatta
ttaaagcactcgcacaagaaattgcagatgttttcaaaaaatattatttaaatgtaccac
cagatcaagtgattacagaagctgacgctattcataacggcatcattttacttggctgta
gcatcggtttacttgttataagcttattcttccgtaatcgcatgcctcgtttaaaataat
gttatatagtagggattgggacagaaatgttattttcacaaaattcatttcgttgaccca
cttcctgctttttctttattaatgacctactacgtcaatgccaaattttaatataattcc
tctaacattctataaatcaacaaataaaaaaagtatcgataaccatatttggcaccgata
ctttaaaaatcatgtccccacaacataatttttgattagtcacacttcaattaatttatt
ttatttattcatgattgatactattatctgcatctaacttttgagctgtagcttttgctt
ttttattactttgtaaaaataaacataaaattaaggcgatgatgctaaatatcgttgcaa
ctataaatgcatcattaataccttcaaccgttgctagtttatttacaaattgtagtaaca
ctttcattgcgccttcttgtccgccatattgtgatgctaattcatgcatatgatcttgta
caacaggattcgttttatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL2346 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2297 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68524.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.192 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108339: hypothetical protein
fig|426430.6.peg.2181 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108339: hypothetical protein
fig|426430.8.peg.2450 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108339: hypothetical protein
fig|451516.9.peg.2442 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108339: hypothetical protein
fig|452948.4.peg.1206 Staphylococcus aureus 930918-3 FIG   FIG01108339: hypothetical protein
fig|546342.3.peg.1031 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108339: hypothetical protein
fig|546343.3.peg.1314 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108339: hypothetical protein
fig|548474.3.peg.525 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108339: hypothetical protein
fig|553567.3.peg.2128 Staphylococcus aureus A5948 FIG   FIG01108339: hypothetical protein
fig|553590.4.peg.956 Staphylococcus aureus A9754 FIG   FIG01108339: hypothetical protein
fig|553594.3.peg.2108 Staphylococcus aureus A9765 FIG   FIG01108339: hypothetical protein
fig|644279.4.peg.2494 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108339: hypothetical protein
fig|93062.19.peg.2292 Staphylococcus aureus subsp. aureus COL FIG   FIG01108339: hypothetical protein
fig|93062.4.peg.2406 Staphylococcus aureus subsp. aureus COL FIG   FIG01108339: hypothetical protein
gb|AAW37174.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22632.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABX30324.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EES96659.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV82540.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45028.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1559
gi|150375264 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222464 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2252
gi|160369353 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161510544 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2332
gi|221138039 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05203
gi|221141284 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06538
gi|253727930 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253734235 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|257859696 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452624 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159993 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1559
gi|57285080 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650894 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2346
gi|87128118 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162144 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2297
img|637153105 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888940 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|640796683 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310338 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641773180 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_2297 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2346 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2252 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sax:USA300HOU_2332 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333286.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2252
ref|YP_001576203.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2332
ref|YP_187152.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2346
ref|YP_494932.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2297
ref|ZP_03562841.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05203
ref|ZP_03565777.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06538
ref|ZP_04868400.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05700628.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJJ2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z541 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|C5Q2N1 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|Q2FEE6 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q5HDK5 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search