The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2451: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: FIG01107838: hypothetical protein
Translate Function Assignments



Context on contig NC_007793 from base 2462170 to 2473016 (10847 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2445 2462170 2462313 144 +           Doubtful CDS  
2446 2462401 2463009 609 + 87     1: 15   DNA-3-methyladenine glycosylase II (EC 3.2.2.21) locus|SAUSA300_2290, protein_id|YP_494925.1, gi|87160626, geneID|3915061
2447 2463346 2464554 1209 + 336         Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 3 10 12 14   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 9   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 13 6 4 8 5 2 11   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 7   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625
2453 2468869 2469507 639 + 270         FIG01108339: hypothetical protein locus|SAUSA300_2297, protein_id|YP_494932.1, gi|87162144, geneID|3914691
2454 2471684 2469753 1932 - 245     1: 1   Membrane component of multidrug resistance system locus|SAUSA300_2298, protein_id|YP_494933.1, gi|87161734, geneID|3913020
2455 2472344 2471697 648 - 12     1: 1   Multidrug resistance protein [function not yet clear] locus|SAUSA300_2299, protein_id|YP_494934.1, gi|87160414, geneID|3913132
2456 2472465 2473016 552 + 120     1: 1   TetR family regulatory protein of MDR cluster locus|SAUSA300_2300, protein_id|YP_494935.1, gi|87162322, geneID|3913456

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2451 FIG01107838: hypothetical protein
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH

MD5 = 5e5ed2814340367762287a17640714fa


  DNA Sequence

>fig|451515.3.peg.2451 FIG01107838: hypothetical protein
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagccatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaggttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2451 FIG01107838: hypothetical protein
gtcactaaggagatggttattatcaaacaactttttacacatactcaaaccgtaacatct
gaattcattgaccataacaatcatatgcatgatgcaaattataatatcatttttagtgac
gtcgtgaatcgttttaattacagccacggtctttctttaaaagaacgcgaaaatttagca
tatacgctatttacactagaagaacatacgacatacctctcagaattgtctcttggcgat
gtatttactgttactttatatatttatgattacgattataagcggttgcatttattttta
acattaactaaagaagatggtacactagcatcaacaaatgaagtaatgatgatgggaatt
aatcagcacacacgtcgttctgatgcttttcctgaatcattttcaacacaaatagcacac
tattataaaaatcaatcaactatcacttggcctgaacaattaggacataaaatagcaatt
ccacacaaaggagcattaaaatgacagatgcattacaacaaaagattcatatcgaattac
tagatttattagatgatgttaagtttgaattaacagaattaaatgcacaaaaagggttat
acattaacggaccagcaaatcagctacttaagcgtggcgtgcatatggcttatgttcaag
gacaaaagcaagccatcgataatattatgactattgtggaacaacagcttgaagatcaac
atttcctagaacattatgataaatttcaaaatgaggttgctcatcgcaattatgataaaa
cagctaactttgcagaacttagtgatattccacgtcaattcgataattttttagatcaat
tttatcaaattaaagggcaatactttatcatcacacatatcaatacacttattggtgatt
ttcactcagaagctcattaacaattagtctatataacccttgctatattttcaaaaacaa
aacccaattacgttttcatgtcaaatatcatcttgcatgaaatcgtaactgggtcattta
tatgttattagttattttgtgttacatcctcatctatcgatttggcaatttgtttaatag
ctttatgtgattgtctaattggataaattggaaaatcatgtaccatcttaggataatcat
aaaactcaatgtattgatgatgttgcaacatcatttgttcaaatagcttcatatcaggat
gtgtcatttcacgtccaccaccaaacatataaactggtggcaatccttctattgtgccat
taattggcgatatgcgcttatctgttaatggtaggccattcgcccattttttcataatct
cattgacaccaaactgacttagaaccgcatcttgttcgattaaggcgtccgaaatatctt
tattagatagtgttgcatctaaaattggtgagattaaata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA2445 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA2365 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT08SA2406 Staphylococcus aureus subsp. aureus MRSA252     conserved hypothetical protein
cmr|NT09SA2251 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|NT11SA2231 Staphylococcus aureus RF122     conserved hypothetical protein
cmr|SACOL2344 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_2295 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB96135.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF68522.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG41416.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical protein
emb|CAG44053.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
emb|CAI81917.1 Staphylococcus aureus RF122 EMBL   hypothetical protein
fig|196620.1.peg.2270 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107838: hypothetical protein
fig|196620.5.peg.2347 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107838: hypothetical protein
fig|273036.3.peg.2166 Staphylococcus aureus RF122 FIG   FIG01107838: hypothetical protein
fig|273036.6.peg.2348 Staphylococcus aureus RF122 FIG   FIG01107838: hypothetical protein
fig|282458.1.peg.2305 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01107838: hypothetical protein
fig|282458.4.peg.2456 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01107838: hypothetical protein
fig|282459.1.peg.2219 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107838: hypothetical protein
fig|282459.5.peg.2330 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107838: hypothetical protein
fig|367830.3.peg.2583 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107838: hypothetical protein
fig|426430.6.peg.2179 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107838: hypothetical protein
fig|426430.8.peg.2448 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107838: hypothetical protein
fig|451516.9.peg.2440 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107838: hypothetical protein
fig|452948.4.peg.1208 Staphylococcus aureus 930918-3 FIG   FIG01107838: hypothetical protein
fig|455227.3.peg.1842 Staphylococcus aureus D30 FIG   FIG01107838: hypothetical protein
fig|546342.3.peg.1033 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107838: hypothetical protein
fig|546343.3.peg.1312 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107838: hypothetical protein
fig|548470.3.peg.993 Staphylococcus aureus subsp. aureus MN8 FIG   FIG01107838: hypothetical protein
fig|548473.3.peg.241 Staphylococcus aureus subsp. aureus TCH60 FIG   FIG01107838: hypothetical protein
fig|548475.3.peg.1820 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01107838: hypothetical protein
fig|553567.3.peg.2259 Staphylococcus aureus A5948 FIG   FIG01107838: hypothetical protein
fig|553583.3.peg.1243 Staphylococcus aureus A9635 FIG   FIG01107838: hypothetical protein
fig|553590.4.peg.954 Staphylococcus aureus A9754 FIG   FIG01107838: hypothetical protein
fig|553594.3.peg.2106 Staphylococcus aureus A9765 FIG   FIG01107838: hypothetical protein
fig|585143.3.peg.825 Staphylococcus aureus subsp. aureus 55/2053 FIG   FIG01107838: hypothetical protein
fig|585144.3.peg.814 Staphylococcus aureus subsp. aureus 58-424 FIG   FIG01107838: hypothetical protein
fig|585145.3.peg.623 Staphylococcus aureus subsp. aureus 65-1322 FIG   FIG01107838: hypothetical protein
fig|585146.3.peg.194 Staphylococcus aureus subsp. aureus 68-397 FIG   FIG01107838: hypothetical protein
fig|585147.3.peg.1907 Staphylococcus aureus subsp. aureus A017934/97 FIG   FIG01107838: hypothetical protein
fig|585148.3.peg.2133 Staphylococcus aureus subsp. aureus Btn1260 FIG   FIG01107838: hypothetical protein
fig|585149.6.peg.2525 Staphylococcus aureus subsp. aureus C101 FIG   FIG01107838: hypothetical protein
fig|585150.3.peg.742 Staphylococcus aureus subsp. aureus C160 FIG   FIG01107838: hypothetical protein
fig|585151.3.peg.2335 Staphylococcus aureus subsp. aureus C427 FIG   FIG01107838: hypothetical protein
fig|585152.3.peg.2330 Staphylococcus aureus subsp. aureus D139 FIG   FIG01107838: hypothetical protein
fig|585153.3.peg.623 Staphylococcus aureus subsp. aureus E1410 FIG   FIG01107838: hypothetical protein
fig|585154.3.peg.2414 Staphylococcus aureus subsp. aureus EMRSA16 FIG   FIG01107838: hypothetical protein
fig|585155.3.peg.895 Staphylococcus aureus subsp. aureus H19 FIG   FIG01107838: hypothetical protein
fig|585156.3.peg.1905 Staphylococcus aureus subsp. aureus M1015 FIG   FIG01107838: hypothetical protein
fig|585157.3.peg.2022 Staphylococcus aureus subsp. aureus M809 FIG   FIG01107838: hypothetical protein
fig|585158.3.peg.402 Staphylococcus aureus subsp. aureus M876 FIG   FIG01107838: hypothetical protein
fig|585159.3.peg.2458 Staphylococcus aureus subsp. aureus M899 FIG   FIG01107838: hypothetical protein
fig|585160.3.peg.2165 Staphylococcus aureus subsp. aureus WBG10049 FIG   FIG01107838: hypothetical protein
fig|585161.3.peg.2220 Staphylococcus aureus subsp. aureus WW2703/97 FIG   FIG01107838: hypothetical protein
fig|644279.4.peg.2492 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107838: hypothetical protein
fig|762962.3.peg.2161 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01107838: hypothetical protein
fig|93061.3.peg.2479 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107838: hypothetical protein
fig|93061.5.peg.2375 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107838: hypothetical protein
fig|93062.19.peg.2290 Staphylococcus aureus subsp. aureus COL FIG   FIG01107838: hypothetical protein
fig|93062.4.peg.2404 Staphylococcus aureus subsp. aureus COL FIG   FIG01107838: hypothetical protein
gb|AAW37172.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL2344
gb|ABD20447.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31635.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30322.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2330
gb|EEI96430.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EEJ62618.1 Staphylococcus aureus subsp. aureus TCH60     conserved hypothetical protein
gb|EES56060.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV04951.1 Staphylococcus aureus subsp. aureus 55/2053     conserved hypothetical protein
gb|EEV07595.1 Staphylococcus aureus subsp. aureus 65-1322     conserved hypothetical protein
gb|EEV10218.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV12807.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV15468.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV70143.1 Staphylococcus aureus A9635     conserved hypothetical protein
gb|EEV82379.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45027.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1558
gb|EEW46695.1 Staphylococcus aureus D30     hypothetical protein SAD30_0156
gi|150375262 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222462 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2250
gi|160369351 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2330
gi|161510542 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2330
gi|21205442 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21283999 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2270
gi|221138041 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05213
gi|221141282 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06528
gi|227246671 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227556813 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227852820 Staphylococcus aureus subsp. aureus TCH60 NCBI   conserved hypothetical protein
gi|227898874 Staphylococcus aureus subsp. aureus TCH60 NCBI   conserved hypothetical protein
gi|251803403 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813220 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|257272849 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257276144 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257279631 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257282675 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257285352 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257423831 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257426513 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257429150 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257431796 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257434756 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257846116 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|257859527 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258423724 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|258452764 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159992 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1558
gi|259162117 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0156
gi|49242693 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein
gi|49245575 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49484564 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR2434
gi|49487132 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2240
gi|57285078 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2344
gi|57650892 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2344
gi|82657475 Staphylococcus aureus RF122 NCBI   hypothetical protein
gi|82751944 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB2228
gi|87125933 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87159959 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2295
gi|87203825 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196267 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02626
img|637153103 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637155866 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637158510 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300087 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817209 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637888938 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895236 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796681 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310336 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641773178 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2295 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sab:SAB2228 Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL2344 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2250 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW2270 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02626 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR2434   KEGG   hypothetical protein
kegg|sas:SAS2240   KEGG   hypothetical protein
kegg|sax:USA300HOU_2330 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_647087.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2270
ref|YP_001333284.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2250
ref|YP_001576201.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2330
ref|YP_041788.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR2434
ref|YP_044353.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2240
ref|YP_187150.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2344
ref|YP_417685.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB2228
ref|YP_494930.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2295
ref|YP_501087.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02626
ref|ZP_03562843.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05213
ref|ZP_03565775.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06528
ref|ZP_03986860.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_04016679.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   conserved hypothetical protein
ref|ZP_04827693.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_05600260.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   conserved hypothetical protein
ref|ZP_05602915.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   conserved hypothetical protein
ref|ZP_05605537.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05608159.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05610807.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05686611.1 Staphylococcus aureus A9635 RefSeq   conserved hypothetical protein
ref|ZP_05700760.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJJ0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z539 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C2G8J6 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Putative uncharacterized protein
tr|C2K420 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|C5QFX7 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FEE8 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G2W6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YYY6 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HDK7 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G6X1 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GE85 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q8NV53 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2270


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search