The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2448: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
Translate Function Assignments



Context on contig NC_007793 from base 2459000 to 2471684 (12685 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2441 2460232 2459000 1233 -           ABC-type Na+ efflux pump, permease component locus|SAUSA300_2287, protein_id|YP_494922.1, gi|87161971, geneID|3914483
2442 2461124 2460225 900 - -8         ABC transporter, ATP-binding protein locus|SAUSA300_2288, protein_id|YP_494923.1, gi|87161206, geneID|3912781
2443 2462002 2461355 648 - 230         FIG01108220: hypothetical protein locus|SAUSA300_2289, protein_id|YP_494924.1, gi|87162419, geneID|3915266
2444 2461994 2462116 123 + -9         Doubtful CDS  
2445 2462170 2462313 144 + 53         Doubtful CDS  
2446 2462401 2463009 609 + 87     1: 14   DNA-3-methyladenine glycosylase II (EC 3.2.2.21) locus|SAUSA300_2290, protein_id|YP_494925.1, gi|87160626, geneID|3915061
2447 2463346 2464554 1209 + 336         Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 2 10 11 15   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 8   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 13 5 3 7 4 1 12   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 6   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625
2453 2468869 2469507 639 + 270         FIG01108339: hypothetical protein locus|SAUSA300_2297, protein_id|YP_494932.1, gi|87162144, geneID|3914691
2454 2471684 2469753 1932 - 245     1: 9   Membrane component of multidrug resistance system locus|SAUSA300_2298, protein_id|YP_494933.1, gi|87161734, geneID|3913020

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Archaeal_lipids gjo Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
Isoprenoid_Biosynthesis:_Interconversions RossO Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
Isoprenoid_Biosynthesis OlgaZ Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
archaeal_lipids_bobik Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)


  Protein Sequence

>fig|451515.3.peg.2448 Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
MSDFQREQRKNEHVEIAMAQSDAMHSDFDKMRFVHHSIPSINVNDIDLTSQTPDLTMAYP
VYINAMTGGSEWTKNINEKLAVVARETGLAMAVGSTHAALRNPRMAETFTIARKMNPEGM
IFSNVGADVPVEKALEAVELLEAQALQIHVNSPQELVMPEGNREFVTWLDNIASIVSRVS
VPVIIKEVGFGMSKELMHDLQQIGVKYVDVSGKGGTNFVDIENERRANKDMDYLSSWGQS
TVESLLETTAYQSEISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVENNGIAHTVA
YVESFIEHMKSIMTMLDAKNIDDLTQKQIVFSPEILSWIEQRNLNIHRG

MD5 = 64b4398cf6a7aebe8594cdd05c2df4c0


  DNA Sequence

>fig|451515.3.peg.2448 Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
atgagtgattttcaaagagaacagagaaaaaatgaacatgttgaaatagcaatggcccaa
tctgacgcaatgcattcagattttgataagatgcgttttgtgcatcattctatcccatca
attaatgtaaatgatatcgatttgacatcacagacgcctgacttaacgatggcatatccg
gtttatattaatgcaatgacgggtggtagcgagtggacgaaaaacatcaatgaaaagcta
gctgtagttgcaagagaaactggcttagcgatggcagttggatcaacacatgcggcattg
agaaatccacgcatggctgagacgtttacgattgcgcgaaaaatgaatcctgaaggcatg
atttttagcaatgttggtgcggacgtaccagtagaaaaggctttggaagcagttgaatta
cttgaggcacaagcgttacaaatccatgttaattctcctcaagaattagttatgcctgaa
gggaatcgtgaatttgtgacttggttagataatatagcgtcgattgtatcacgagtgtct
gttccagtcattataaaagaagttggatttggtatgagcaaagaattaatgcatgactta
caacaaataggcgtcaagtatgtcgatgttagtggcaaaggtggtactaactttgtagat
attgaaaatgaacgtcgtgcaaataaagatatggattacttatcatcatggggacagtct
acagttgagtcattacttgaaacaacggcttatcaaagcgaaatttcagttttcgcgagt
ggtggtttacgtacaccactcgatgcaattaaaagtttagcacttggtgcaaaggcaact
ggtatgtcacgtccgtttttaaatcaagttgaaaataatggcattgcacatacagtagct
tatgtagaatcatttattgaacacatgaaatcaataatgacgatgttagatgctaaaaat
attgacgacttaacacaaaaacaaatcgtatttagtccggaaatattgtcatggatagaa
caacgtaacttgaatatacatcgaggataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2448 Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
accgccatgtagatgatcgctttaataaaatggtcatggatagtgtctttaagttacgtt
cggatttgattaaagtaaaacgtgtactgtttcctatgcaagagctaattgatacaatga
aacaaaatggtgatttgattatagataataaacattcgctatacattcaacatatcgatg
accacttgattaagcaacgtaatatcattcgtactgctcaagaaatgacaaacgaaatac
gagaaaattttgagtcatacacgtcatttagaatgaatagtattatgcaagtactgacat
tagtatcagttatattttcaccgttaacattcatagctgggatttatggtatgaactttg
taaatatgccggcattacatttacattatggatattatatttgcttagctgtaatgtttg
ttatagctgtcgtattaatcatctttttcagacgtaaaaaatggttttaaattagaaatg
acgaaaaggtaggtttaatcatgagtgattttcaaagagaacagagaaaaaatgaacatg
ttgaaatagcaatggcccaatctgacgcaatgcattcagattttgataagatgcgttttg
tgcatcattctatcccatcaattaatgtaaatgatatcgatttgacatcacagacgcctg
acttaacgatggcatatccggtttatattaatgcaatgacgggtggtagcgagtggacga
aaaacatcaatgaaaagctagctgtagttgcaagagaaactggcttagcgatggcagttg
gatcaacacatgcggcattgagaaatccacgcatggctgagacgtttacgattgcgcgaa
aaatgaatcctgaaggcatgatttttagcaatgttggtgcggacgtaccagtagaaaagg
ctttggaagcagttgaattacttgaggcacaagcgttacaaatccatgttaattctcctc
aagaattagttatgcctgaagggaatcgtgaatttgtgacttggttagataatatagcgt
cgattgtatcacgagtgtctgttccagtcattataaaagaagttggatttggtatgagca
aagaattaatgcatgacttacaacaaataggcgtcaagtatgtcgatgttagtggcaaag
gtggtactaactttgtagatattgaaaatgaacgtcgtgcaaataaagatatggattact
tatcatcatggggacagtctacagttgagtcattacttgaaacaacggcttatcaaagcg
aaatttcagttttcgcgagtggtggtttacgtacaccactcgatgcaattaaaagtttag
cacttggtgcaaaggcaactggtatgtcacgtccgtttttaaatcaagttgaaaataatg
gcattgcacatacagtagcttatgtagaatcatttattgaacacatgaaatcaataatga
cgatgttagatgctaaaaatattgacgacttaacacaaaaacaaatcgtatttagtccgg
aaatattgtcatggatagaacaacgtaacttgaatatacatcgaggataaataaaagagg
aggcgaaggcctcctcttttatttatgagtttggtgtttaactaaaccattgtatgaatc
ccataatgactataacaccaattaaatcgattaagaatgcaccaacaataggtacaacta
aatatgctttaggtgagtttccatattttttagtaataacatctaaatttgccatggcat
ttggcgttgcaccaagcccatgaccgataaaaccacctaccattactgcagcatcataat
cttttcctaaacctctaaataaaattaaaacagcaaataaaatcataacgacaacttgaa
ctaaaacgataataataagaggtatagcaagtttataaatttcgattaattgaatgctca
ttagcgcaagagataagaaaatacctaatgcgacatcgccaatttgattagtaattttta
aatctacaatattaaaattaaaactttcagagatatttcggacaataacagctacaaata
atgagccaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004452       F:isopentenyl-diphosphate delta-isomerase act...
GO:0005737       C:cytoplasm
GO:0008299       P:isoprenoid biosynthetic process
GO:0010181       F:FMN binding
GO:0016491       F:oxidoreductase activity
cmr|NT05SA2362 Staphylococcus aureus NCTC 8325     isopentenyl-diphosphate delta-isomerase, type 2
cmr|SACOL2341 Staphylococcus aureus subsp. aureus COL     isopentenyl diphosphate isomerase
cmr|SAUSA300_2292 Staphylococcus aureus subsp. aureus USA300-FPR3757     isopentenyl-diphosphate delta-isomerase
dbj|BAF68519.1 Staphylococcus aureus subsp. aureus str. Newman     isopentenyl-diphosphate delta-isomerase
fig|367830.3.peg.2580 Staphylococcus aureus subsp. aureus USA300 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|426430.6.peg.2176 Staphylococcus aureus subsp. aureus str. Newman FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|426430.8.peg.2445 Staphylococcus aureus subsp. aureus str. Newman FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|450394.6.peg.1847 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|451516.9.peg.2437 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|452948.4.peg.1211 Staphylococcus aureus 930918-3 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|455227.3.peg.1845 Staphylococcus aureus D30 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|546342.3.peg.1036 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|546343.3.peg.1309 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|548474.3.peg.530 Staphylococcus aureus subsp. aureus TCH130 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|553567.3.peg.2262 Staphylococcus aureus A5948 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|553590.4.peg.951 Staphylococcus aureus A9754 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|553594.3.peg.2103 Staphylococcus aureus A9765 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|644279.4.peg.2489 Staphylococcus aureus subsp. aureus 132 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|93061.3.peg.2476 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|93061.5.peg.2372 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|93062.19.peg.2287 Staphylococcus aureus subsp. aureus COL FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
fig|93062.4.peg.2401 Staphylococcus aureus subsp. aureus COL FIG   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
gb|AAW37169.1 Staphylococcus aureus subsp. aureus COL     isopentenyl diphosphate isomerase
gb|ABD20739.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     isopentenyl-diphosphate delta-isomerase
gb|ABD31632.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30319.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     isopentenyl-diphosphate delta-isomerase
gb|EES94958.1 Staphylococcus aureus subsp. aureus USA300_TCH959     isopentenyl pyrophosphate isomerase
gb|EES96664.1 Staphylococcus aureus subsp. aureus TCH130     isopentenyl pyrophosphate isomerase
gb|EEV82382.1 Staphylococcus aureus A5948     isopentenyl-diphosphate delta-isomerase, type 2
gb|EEW45049.1 Staphylococcus aureus 930918-3     isopentenyl pyrophosphate isomerase
gb|EEW46692.1 Staphylococcus aureus D30     isopentenyl pyrophosphate isomerase
gi|122538789 organism not parsed/found in ncbi nr NCBI   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
gi|123484672 organism not parsed/found in ncbi nr NCBI   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
gi|150375259 Staphylococcus aureus subsp. aureus str. Newman NCBI   isopentenyl-diphosphate delta-isomerase
gi|151222459 Staphylococcus aureus subsp. aureus str. Newman NCBI   isopentenyl pyrophosphate isomerase
gi|160369348 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   isopentenyl-diphosphate delta-isomerase
gi|161510539 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   isopentenyl pyrophosphate isomerase
gi|172049061 organism not parsed/found in ncbi nr NCBI   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
gi|189044245 organism not parsed/found in ncbi nr NCBI   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
gi|221138044 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   isopentenyl pyrophosphate isomerase
gi|221141279 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   isopentenyl pyrophosphate isomerase
gi|253726229 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   isopentenyl pyrophosphate isomerase
gi|253727935 Staphylococcus aureus subsp. aureus TCH130 NCBI   isopentenyl pyrophosphate isomerase
gi|253730016 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   isopentenyl pyrophosphate isomerase
gi|253734240 Staphylococcus aureus subsp. aureus TCH130 NCBI   isopentenyl pyrophosphate isomerase
gi|257859530 Staphylococcus aureus A5948 NCBI   isopentenyl-diphosphate delta-isomerase, type 2
gi|258452767 Staphylococcus aureus A5948 NCBI   isopentenyl-diphosphate delta-isomerase, type 2
gi|259160014 Staphylococcus aureus 930918-3 NCBI   isopentenyl pyrophosphate isomerase
gi|259162114 Staphylococcus aureus D30 NCBI   isopentenyl pyrophosphate isomerase
gi|57285075 Staphylococcus aureus subsp. aureus COL NCBI   isopentenyl diphosphate isomerase
gi|57650889 Staphylococcus aureus subsp. aureus COL NCBI   isopentenyl pyrophosphate isomerase
gi|71152145 organism not parsed/found in ncbi nr NCBI   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
gi|87126225 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   isopentenyl-diphosphate delta-isomerase
gi|87160251 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   isopentenyl pyrophosphate isomerase
gi|87203822 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196264 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   isopentenyl pyrophosphate isomerase
img|637153100 Staphylococcus aureus aureus COL IMG   isopentenyl pyrophosphate isomerase( EC:5.3.3.2 )
img|637888935 Staphylococcus aureus aureus USA300 IMG   isopentenyl-diphosphate delta-isomerase( EC:5.3.3.2 )
img|637895233 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796678 Staphylococcus aureus aureus Newman IMG   isopentenyl-diphosphate delta-isomerase
img|641310333 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   isopentenyl-diphosphate delta-isomerase( EC:5.3.3.2 )
img|641773175 Staphylococcus aureus aureus USA300_TCH959 IMG   isopentenyl-diphosphate delta-isomerase
kegg|saa:SAUSA300_2292 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   isopentenyl pyrophosphate isomerase (EC:5.3.3.2)
kegg|sac:SACOL2341 Staphylococcus aureus subsp. aureus COL KEGG   isopentenyl pyrophosphate isomerase (EC:5.3.3.2)
kegg|sae:NWMN_2247 Staphylococcus aureus subsp. aureus Newman KEGG   isopentenyl pyrophosphate isomerase (EC:5.3.3.2)
kegg|sao:SAOUHSC_02623 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   isopentenyl pyrophosphate isomerase (EC:5.3.3.2)
kegg|sax:USA300HOU_2327 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   isopentenyl pyrophosphate isomerase (EC:5.3.3.2)
ref|YP_001333281.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   isopentenyl pyrophosphate isomerase
ref|YP_001576198.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   isopentenyl pyrophosphate isomerase
ref|YP_187147.1 Staphylococcus aureus subsp. aureus COL RefSeq   isopentenyl pyrophosphate isomerase
ref|YP_494927.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   isopentenyl pyrophosphate isomerase
ref|YP_501084.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   isopentenyl pyrophosphate isomerase
ref|ZP_03562846.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   isopentenyl pyrophosphate isomerase
ref|ZP_03565772.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   isopentenyl pyrophosphate isomerase
ref|ZP_04864181.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   isopentenyl pyrophosphate isomerase
ref|ZP_04868405.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   isopentenyl pyrophosphate isomerase
ref|ZP_05700763.1 Staphylococcus aureus A5948 RefSeq   isopentenyl-diphosphate delta-isomerase, type 2
sp|A6QJI7 Staphylococcus aureus (strain Newman) SwissProt   Isopentenyl-diphosphate delta-isomerase
sp|A8Z536 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Isopentenyl-diphosphate delta-isomerase
sp|IDI2_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
sp|IDI2_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
sp|IDI2_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
sp|IDI2_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
sp|IDI2_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase
sp|Q2FEF1 Staphylococcus aureus (strain USA300) SwissProt   Isopentenyl-diphosphate delta-isomerase
sp|Q2FVR9 Staphylococcus aureus (strain NCTC 8325) SwissProt   Isopentenyl-diphosphate delta-isomerase
sp|Q5HDL0 Staphylococcus aureus (strain COL) SwissProt   Isopentenyl-diphosphate delta-isomerase
tr|C5MZN9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Isopentenyl pyrophosphate isomerase
tr|C5Q2N6 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Isopentenyl pyrophosphate isomerase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search