The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2447: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Sodium/glutamate symport protein
Translate Function Assignments



Context on contig NC_007793 from base 2457407 to 2469507 (12101 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2439 2458426 2457407 1020 -           Aldose 1-epimerase (EC 5.1.3.3) gene_name|galM, locus|SAUSA300_2285, protein_id|YP_494920.1, gi|87161694, geneID|3914459
2440 2458782 2458456 327 - 29         Protein of unknown function UPF0060 locus|SAUSA300_2286, protein_id|YP_494921.1, gi|87162407, geneID|3915254
2441 2460232 2459000 1233 - 217         ABC-type Na+ efflux pump, permease component locus|SAUSA300_2287, protein_id|YP_494922.1, gi|87161971, geneID|3914483
2442 2461124 2460225 900 - -8         ABC transporter, ATP-binding protein locus|SAUSA300_2288, protein_id|YP_494923.1, gi|87161206, geneID|3912781
2443 2462002 2461355 648 - 230         FIG01108220: hypothetical protein locus|SAUSA300_2289, protein_id|YP_494924.1, gi|87162419, geneID|3915266
2444 2461994 2462116 123 + -9         Doubtful CDS  
2445 2462170 2462313 144 + 53         Doubtful CDS  
2446 2462401 2463009 609 + 87     1: 13   DNA-3-methyladenine glycosylase II (EC 3.2.2.21) locus|SAUSA300_2290, protein_id|YP_494925.1, gi|87160626, geneID|3915061
2447 2463346 2464554 1209 + 336         Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 2 9 10 14   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 8   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 12 5 3 7 4 1 11   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 6   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625
2453 2468869 2469507 639 + 270         FIG01108339: hypothetical protein locus|SAUSA300_2297, protein_id|YP_494932.1, gi|87162144, geneID|3914691

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2447 Sodium/glutamate symport protein
MIELNAITTLCLACILYLLGKAIVNHVNFLKRICIPAPVIGGLIFAILVAALDSFGMVKI
KLDASFIQDFFMLAFFTTIGLGASLKLFKLGGKVLLLYFMFCAIISVIQNIVGVSLAKVL
NIKPLLGLTAGSMSMEGGHGNAAAYGKTIQDLGIDSALTAALAAATLGLVFGGLIGGPVV
KFLIKRYNLKPQHSDDTFKDYSQVAYNEHLHSKFNATEVFFIQFTIVVFCMAVGSYFSHL
FTAQTGINVPIYVGSLFVAVIVRNISESFNFNIVDLKITNQIGDVALGIFLSLALMSIQL
IEIYKLAIPLIIIVLVQVVVMILFAVLILFRGLGKDYDAAVMVGGFIGHGLGATPNAMAN
LDVITKKYGNSPKAYLVVPIVGAFLIDLIGVIVIMGFIQWFS

MD5 = b18f6c397e429d92e59b6f06e4ca9bbe


  DNA Sequence

>fig|451515.3.peg.2447 Sodium/glutamate symport protein
atgatagaacttaatgcaattacaacattatgtttagcttgtatcctttatttacttggt
aaggctatcgttaatcacgttaattttttaaaacgtatttgtataccagcaccagtgatt
ggcggcttaatctttgctattttagttgcggctttggattcatttggcatggttaagatt
aaattagatgcttcattcattcaagatttcttcatgttagcattctttacgacaatcggt
cttggtgcatcattgaaattatttaaattaggtggcaaagtcttgctattatactttatg
ttttgtgctatcatttcagtcattcaaaacatagttggtgtatcactagcaaaagtatta
aatattaaacctttgttaggattaacagcaggttccatgtctatggaaggcggtcatggt
aatgctgctgcttatggtaagacaattcaagatttaggtattgattcggcactgacagcg
gctcttgcagctgcaactttaggtcttgtatttggagggcttatcggtggtccagttgta
aaatttttaatcaaacgttataacttaaagcctcaacatagtgacgatacatttaaagat
tatagccaagtagcatataacgaacatttacatagtaaatttaatgccactgaagtattc
ttcattcaatttacaatcgttgtattctgtatggcagttggaagttatttcagtcatttg
tttacagctcaaacagggattaatgttccaatttacgttggctcattatttgtagctgtt
attgtccgaaatatctctgaaagttttaattttaatattgtagatttaaaaattactaat
caaattggcgatgtcgcattaggtattttcttatctcttgcgctaatgagcattcaatta
atcgaaatttataaacttgctatacctcttattattatcgttttagttcaagttgtcgtt
atgattttatttgctgttttaattttatttagaggtttaggaaaagattatgatgctgca
gtaatggtaggtggttttatcggtcatgggcttggtgcaacgccaaatgccatggcaaat
ttagatgttattactaaaaaatatggaaactcacctaaagcatatttagttgtacctatt
gttggtgcattcttaatcgatttaattggtgttatagtcattatgggattcatacaatgg
tttagttaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2447 Sodium/glutamate symport protein
agaatcgtaaatatcctaaagatattattgctagtccacgaatcggtattccaaataaag
gtgattggacacataaatctttacgttacacagtgaaaggtaatccatttgtgtctcgca
tgcgtaaatcagattgtatgtttcccgaagatacttggaaataaatgccatctttcattg
attactatcatgaaaatgaaatctatctccttataagtcaatcaatcgtgccgtcaacat
gcggatgggttgattgtttttctttgtatccatcatattttttgattcatctcctcttat
tgaacttgttcttaattataaaatataacaatagaattatttataattattaaatttaga
tgcattaatattattgatattattttcaaaaactagaaatattgatttgttgcatgtata
atgttaaaagcgcccttttataacgcttacatataaaagcttatttagggagagggatat
tcaacaagggggatttgaaaatgatagaacttaatgcaattacaacattatgtttagctt
gtatcctttatttacttggtaaggctatcgttaatcacgttaattttttaaaacgtattt
gtataccagcaccagtgattggcggcttaatctttgctattttagttgcggctttggatt
catttggcatggttaagattaaattagatgcttcattcattcaagatttcttcatgttag
cattctttacgacaatcggtcttggtgcatcattgaaattatttaaattaggtggcaaag
tcttgctattatactttatgttttgtgctatcatttcagtcattcaaaacatagttggtg
tatcactagcaaaagtattaaatattaaacctttgttaggattaacagcaggttccatgt
ctatggaaggcggtcatggtaatgctgctgcttatggtaagacaattcaagatttaggta
ttgattcggcactgacagcggctcttgcagctgcaactttaggtcttgtatttggagggc
ttatcggtggtccagttgtaaaatttttaatcaaacgttataacttaaagcctcaacata
gtgacgatacatttaaagattatagccaagtagcatataacgaacatttacatagtaaat
ttaatgccactgaagtattcttcattcaatttacaatcgttgtattctgtatggcagttg
gaagttatttcagtcatttgtttacagctcaaacagggattaatgttccaatttacgttg
gctcattatttgtagctgttattgtccgaaatatctctgaaagttttaattttaatattg
tagatttaaaaattactaatcaaattggcgatgtcgcattaggtattttcttatctcttg
cgctaatgagcattcaattaatcgaaatttataaacttgctatacctcttattattatcg
ttttagttcaagttgtcgttatgattttatttgctgttttaattttatttagaggtttag
gaaaagattatgatgctgcagtaatggtaggtggttttatcggtcatgggcttggtgcaa
cgccaaatgccatggcaaatttagatgttattactaaaaaatatggaaactcacctaaag
catatttagttgtacctattgttggtgcattcttaatcgatttaattggtgttatagtca
ttatgggattcatacaatggtttagttaaacaccaaactcataaataaaagaggaggcct
tcgcctcctcttttatttatcctcgatgtatattcaagttacgttgttctatccatgaca
atatttccggactaaatacgatttgtttttgtgttaagtcgtcaatatttttagcatcta
acatcgtcattattgatttcatgtgttcaataaatgattctacataagctactgtatgtg
caatgccattattttcaacttgatttaaaaacggacgtgacataccagttgcctttgcac
caagtgctaaacttttaattgcatcgagtggtgtacgtaaaccaccactcgcgaaaactg
aaatttcgctttgataagccgttgtttcaagtaatgactcaactgtagactgtccccatg
atgataagtaatccatatctttatttgcacgacgttcattttcaatatctacaaagttag
taccacctttgccactaacatcgacatacttgacgcctatttgttgtaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0015501       F:glutamate:sodium symporter activity
GO:0015813       P:L-glutamate transport
GO:0016021       C:integral to membrane
cmr|NT05SA2361 Staphylococcus aureus NCTC 8325     sodium/glutamate symporter
cmr|NT08SA2402 Staphylococcus aureus subsp. aureus MRSA252     sodium/glutamate symporter
cmr|SACOL2340 Staphylococcus aureus subsp. aureus COL     sodium:glutamate symporter
cmr|SAUSA300_2291 Staphylococcus aureus subsp. aureus USA300-FPR3757     sodium/glutamate symporter
dbj|BAF68518.1 Staphylococcus aureus subsp. aureus str. Newman     sodium/glutamate symporter
emb|CAG41412.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative permease
fig|282458.1.peg.2301 Staphylococcus aureus subsp. aureus MRSA252 FIG   Sodium/glutamate symport protein
fig|282458.4.peg.2452 Staphylococcus aureus subsp. aureus MRSA252 FIG   Sodium/glutamate symport protein
fig|367830.3.peg.2579 Staphylococcus aureus subsp. aureus USA300 FIG   Sodium/glutamate symport protein
fig|426430.6.peg.2175 Staphylococcus aureus subsp. aureus str. Newman FIG   Sodium/glutamate symport protein
fig|426430.8.peg.2444 Staphylococcus aureus subsp. aureus str. Newman FIG   Sodium/glutamate symport protein
fig|450394.6.peg.1846 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Sodium/glutamate symport protein
fig|451516.9.peg.2436 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Sodium/glutamate symport protein
fig|452948.4.peg.1212 Staphylococcus aureus 930918-3 FIG   Sodium/glutamate symport protein
fig|455227.3.peg.1846 Staphylococcus aureus D30 FIG   Sodium/glutamate symport protein
fig|546342.3.peg.1037 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Sodium/glutamate symport protein
fig|546343.3.peg.1308 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Sodium/glutamate symport protein
fig|548473.3.peg.245 Staphylococcus aureus subsp. aureus TCH60 FIG   Sodium/glutamate symport protein
fig|548474.3.peg.531 Staphylococcus aureus subsp. aureus TCH130 FIG   Sodium/glutamate symport protein
fig|553567.3.peg.2263 Staphylococcus aureus A5948 FIG   Sodium/glutamate symport protein
fig|553583.3.peg.1239 Staphylococcus aureus A9635 FIG   Sodium/glutamate symport protein
fig|553590.4.peg.950 Staphylococcus aureus A9754 FIG   Sodium/glutamate symport protein
fig|553594.3.peg.2102 Staphylococcus aureus A9765 FIG   Sodium/glutamate symport protein
fig|585143.3.peg.821 Staphylococcus aureus subsp. aureus 55/2053 FIG   Sodium/glutamate symport protein
fig|585144.3.peg.810 Staphylococcus aureus subsp. aureus 58-424 FIG   Sodium/glutamate symport protein
fig|585145.3.peg.619 Staphylococcus aureus subsp. aureus 65-1322 FIG   Sodium/glutamate symport protein
fig|585146.3.peg.190 Staphylococcus aureus subsp. aureus 68-397 FIG   Sodium/glutamate symport protein
fig|585148.3.peg.2129 Staphylococcus aureus subsp. aureus Btn1260 FIG   Sodium/glutamate symport protein
fig|585149.6.peg.2521 Staphylococcus aureus subsp. aureus C101 FIG   Sodium/glutamate symport protein
fig|585150.3.peg.738 Staphylococcus aureus subsp. aureus C160 FIG   Sodium/glutamate symport protein
fig|585151.3.peg.2331 Staphylococcus aureus subsp. aureus C427 FIG   Sodium/glutamate symport protein
fig|585152.3.peg.2326 Staphylococcus aureus subsp. aureus D139 FIG   Sodium/glutamate symport protein
fig|585153.3.peg.619 Staphylococcus aureus subsp. aureus E1410 FIG   Sodium/glutamate symport protein
fig|585154.3.peg.2410 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Sodium/glutamate symport protein
fig|585156.3.peg.1901 Staphylococcus aureus subsp. aureus M1015 FIG   Sodium/glutamate symport protein
fig|585157.3.peg.2018 Staphylococcus aureus subsp. aureus M809 FIG   Sodium/glutamate symport protein
fig|585158.3.peg.398 Staphylococcus aureus subsp. aureus M876 FIG   Sodium/glutamate symport protein
fig|585160.3.peg.2161 Staphylococcus aureus subsp. aureus WBG10049 FIG   Sodium/glutamate symport protein
fig|644279.4.peg.2488 Staphylococcus aureus subsp. aureus 132 FIG   Sodium/glutamate symport protein
fig|93061.3.peg.2475 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sodium/glutamate symport protein
fig|93061.5.peg.2371 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sodium/glutamate symport protein
fig|93062.4.peg.2400 Staphylococcus aureus subsp. aureus COL FIG   Sodium/glutamate symport protein
gb|AAW37168.1 Staphylococcus aureus subsp. aureus COL     sodium:glutamate symporter
gb|ABD21487.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     sodium/glutamate symporter
gb|ABD31631.1 Staphylococcus aureus subsp. aureus NCTC 8325     sodium/glutamate symporter
gb|ABX30318.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ESS family glutamate:sodium (Na+) symporter
gb|EEJ62622.1 Staphylococcus aureus subsp. aureus TCH60     ESS family glutamate:sodium (Na+) symporter
gb|EES94957.1 Staphylococcus aureus subsp. aureus USA300_TCH959     ESS family glutamate:sodium (Na+) symporter
gb|EES96665.1 Staphylococcus aureus subsp. aureus TCH130     ESS family glutamate:sodium (Na+) symporter
gb|EEV04947.1 Staphylococcus aureus subsp. aureus 55/2053     sodiumglutamate symporter
gb|EEV07591.1 Staphylococcus aureus subsp. aureus 65-1322     sodium/glutamate symporter
gb|EEV10214.1 Staphylococcus aureus subsp. aureus 68-397     sodium/glutamate symporter
gb|EEV12803.1 Staphylococcus aureus subsp. aureus E1410     sodiumglutamate symporter
gb|EEV15464.1 Staphylococcus aureus subsp. aureus M876     sodium/glutamate symporter
gb|EEV70139.1 Staphylococcus aureus A9635     sodium/glutamate symporter
gb|EEV82383.1 Staphylococcus aureus A5948     sodium/glutamate symporter
gi|150375258 Staphylococcus aureus subsp. aureus str. Newman NCBI   sodium/glutamate symporter
gi|151222458 Staphylococcus aureus subsp. aureus str. Newman NCBI   sodium/glutamate symporter
gi|160369347 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|161510538 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|221138045 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|221141278 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|227852824 Staphylococcus aureus subsp. aureus TCH60 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|227898878 Staphylococcus aureus subsp. aureus TCH60 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|253726228 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|253727936 Staphylococcus aureus subsp. aureus TCH130 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|253730015 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|253734241 Staphylococcus aureus subsp. aureus TCH130 NCBI   ESS family glutamate:sodium (Na+) symporter
gi|257272845 Staphylococcus aureus subsp. aureus 55/2053 NCBI   sodiumglutamate symporter
gi|257276140 Staphylococcus aureus subsp. aureus 65-1322 NCBI   sodium/glutamate symporter
gi|257279627 Staphylococcus aureus subsp. aureus 68-397 NCBI   sodium/glutamate symporter
gi|257282671 Staphylococcus aureus subsp. aureus E1410 NCBI   sodiumglutamate symporter
gi|257285348 Staphylococcus aureus subsp. aureus M876 NCBI   sodium/glutamate symporter
gi|257423827 Staphylococcus aureus subsp. aureus 55/2053 NCBI   sodiumglutamate symporter
gi|257426509 Staphylococcus aureus subsp. aureus 65-1322 NCBI   sodium/glutamate symporter
gi|257429146 Staphylococcus aureus subsp. aureus 68-397 NCBI   sodium/glutamate symporter
gi|257431792 Staphylococcus aureus subsp. aureus E1410 NCBI   sodiumglutamate symporter
gi|257434752 Staphylococcus aureus subsp. aureus M876 NCBI   sodium/glutamate symporter
gi|257846112 Staphylococcus aureus A9635 NCBI   sodium/glutamate symporter
gi|257859531 Staphylococcus aureus A5948 NCBI   sodium/glutamate symporter
gi|258423720 Staphylococcus aureus A9635 NCBI   sodium/glutamate symporter
gi|258452768 Staphylococcus aureus A5948 NCBI   sodium/glutamate symporter
gi|49242689 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative permease
gi|49484560 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative permease
gi|57285074 Staphylococcus aureus subsp. aureus COL NCBI   sodium:glutamate symporter
gi|57650888 Staphylococcus aureus subsp. aureus COL NCBI   sodium:glutamate symporter
gi|87126973 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   sodium/glutamate symporter
gi|87160999 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   sodium/glutamate symporter
gi|87203821 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   sodium/glutamate symporter
gi|88196263 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   sodium/glutamate symporter
img|637153099 Staphylococcus aureus aureus COL IMG   sodium:glutamate symporter
img|637155862 Staphylococcus aureus aureus MRSA252 IMG   putative permease
img|637888934 Staphylococcus aureus aureus USA300 IMG   sodium/glutamate symporter
img|637895232 Staphylococcus aureus aureus NCTC 8325 IMG   sodium/glutamate symporter
img|640796677 Staphylococcus aureus aureus Newman IMG   sodium/glutamate symporter
img|641310332 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ESS family glutamate:sodium (Na+) symporter
kegg|saa:SAUSA300_2291 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   sodium/glutamate symporter
kegg|sac:SACOL2340 Staphylococcus aureus subsp. aureus COL KEGG   sodium:glutamate symporter
kegg|sae:NWMN_2246 Staphylococcus aureus subsp. aureus Newman KEGG   sodium/glutamate symporter
kegg|sao:SAOUHSC_02622 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   sodium/glutamate symporter
kegg|sar:SAR2430   KEGG   putative permease
kegg|sax:USA300HOU_2326 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   ESS family glutamate:sodium (Na+) symporter
ref|YP_001333280.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   sodium/glutamate symporter
ref|YP_001576197.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|YP_041784.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative permease
ref|YP_187146.1 Staphylococcus aureus subsp. aureus COL RefSeq   sodium:glutamate symporter
ref|YP_494926.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   sodium/glutamate symporter
ref|YP_501083.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   sodium/glutamate symporter
ref|ZP_03562847.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|ZP_03565771.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|ZP_04016683.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|ZP_04864180.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|ZP_04868406.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   ESS family glutamate:sodium (Na+) symporter
ref|ZP_05600256.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   sodiumglutamate symporter
ref|ZP_05602911.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   sodium/glutamate symporter
ref|ZP_05605533.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   sodium/glutamate symporter
ref|ZP_05608155.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   sodiumglutamate symporter
ref|ZP_05610803.1 Staphylococcus aureus subsp. aureus M876 RefSeq   sodium/glutamate symporter
ref|ZP_05686607.1 Staphylococcus aureus A9635 RefSeq   sodium/glutamate symporter
ref|ZP_05700764.1 Staphylococcus aureus A5948 RefSeq   sodium/glutamate symporter
tr|A6QJI6 Staphylococcus aureus (strain Newman) TrEMBL   Sodium/glutamate symporter
tr|A8Z535 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   ESS family glutamate:sodium (Na+) symporter
tr|C2G8K0 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   ESS family glutamate:sodium (Na+) symporter
tr|C5MZN8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   ESS family glutamate:sodium (Na+) symporter
tr|C5Q2N7 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   ESS family glutamate:sodium (Na+) symporter
tr|Q2FEF2 Staphylococcus aureus (strain USA300) TrEMBL   Sodium/glutamate symporter
tr|Q2FVS0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Sodium/glutamate symporter
tr|Q5HDL1 Staphylococcus aureus (strain COL) TrEMBL   Sodium:glutamate symporter
tr|Q6GE89 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative permease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search