The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2446: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
Translate Function Assignments



Context on contig NC_007793 from base 2457301 to 2468598 (11298 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2438 2457414 2457301 114 -           FIG01108134: hypothetical protein  
2439 2458426 2457407 1020 - -8         Aldose 1-epimerase (EC 5.1.3.3) gene_name|galM, locus|SAUSA300_2285, protein_id|YP_494920.1, gi|87161694, geneID|3914459
2440 2458782 2458456 327 - 29         Protein of unknown function UPF0060 locus|SAUSA300_2286, protein_id|YP_494921.1, gi|87162407, geneID|3915254
2441 2460232 2459000 1233 - 217         ABC-type Na+ efflux pump, permease component locus|SAUSA300_2287, protein_id|YP_494922.1, gi|87161971, geneID|3914483
2442 2461124 2460225 900 - -8         ABC transporter, ATP-binding protein locus|SAUSA300_2288, protein_id|YP_494923.1, gi|87161206, geneID|3912781
2443 2462002 2461355 648 - 230         FIG01108220: hypothetical protein locus|SAUSA300_2289, protein_id|YP_494924.1, gi|87162419, geneID|3915266
2444 2461994 2462116 123 + -9         Doubtful CDS  
2445 2462170 2462313 144 + 53         Doubtful CDS  
2446 2462401 2463009 609 + 87     1: 13   DNA-3-methyladenine glycosylase II (EC 3.2.2.21) locus|SAUSA300_2290, protein_id|YP_494925.1, gi|87160626, geneID|3915061
2447 2463346 2464554 1209 + 336         Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 12 5 6 11   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 4   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 10 3 2 9 1 14 8   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 7   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA_Repair_Base_Excision VeronikaV DNA-3-methyladenine glycosylase II (EC 3.2.2.21)


  Protein Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
KGNPFVSRMRKSDCMFPEDTWK

MD5 = 716269bd776f3a685d5d248025d4e2fd


  DNA Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
atggatttcgttaataatgatacaagacaaattgctaaaaacttattaggtgtcaaagtg
atttatcaggataccactcaaacgtatacaggctacatcgtggaaacggaagcttactta
ggtttgaatgatcgtgcggctcatggctatggcggtaaaataacacctaaagtcacgtca
ttatataaacgtggtggtacaatttatgcacatgtcatgcatacgcatttactcattaat
tttgtaacaaaatctgaaggtatacctgaaggcgtacttatccgcgcaattgaaccagaa
gaaggtttatccgctatgttccgtaacagaggtaagaaaggctacgaggtaacgaatggc
ccaggaaaatggactaaggcatttaacattccacgggctatcgatggcgctacgttaaat
gactgtagattgtctattgatactaagaatcgtaaatatcctaaagatattattgctagt
ccacgaatcggtattccaaataaaggtgattggacacataaatctttacgttacacagtg
aaaggtaatccatttgtgtctcgcatgcgtaaatcagattgtatgtttcccgaagatact
tggaaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
ataccaatattcactacgtcttgatctccccttaaaatttacataatttttccaaaataa
aacgaatgatttcataaaacctacttgaggtaattgttccattgtaatctccctttcgtt
aatcatatttatatttttaattattgttaccgttataatttacaagattcattatcaagc
cacttcatttcaatcgtcaatcactttggaaaatgaactttatatttcatcactagtaaa
atgaaaacccgctacaagtacacatctatatggagactcatttgaaagtcaacgcttcgt
taactatactaaaaatatgtcatactgcaatgttcacgtttaaaagagtctcaatctatg
caaataaaatattccataacaaagtatatactttacatttttataattcttaacaatact
attttatcaaacatttaccacaataaaaatatctttttcatttttatttaaattaatcat
ataattgcgaggagaatattatggatttcgttaataatgatacaagacaaattgctaaaa
acttattaggtgtcaaagtgatttatcaggataccactcaaacgtatacaggctacatcg
tggaaacggaagcttacttaggtttgaatgatcgtgcggctcatggctatggcggtaaaa
taacacctaaagtcacgtcattatataaacgtggtggtacaatttatgcacatgtcatgc
atacgcatttactcattaattttgtaacaaaatctgaaggtatacctgaaggcgtactta
tccgcgcaattgaaccagaagaaggtttatccgctatgttccgtaacagaggtaagaaag
gctacgaggtaacgaatggcccaggaaaatggactaaggcatttaacattccacgggcta
tcgatggcgctacgttaaatgactgtagattgtctattgatactaagaatcgtaaatatc
ctaaagatattattgctagtccacgaatcggtattccaaataaaggtgattggacacata
aatctttacgttacacagtgaaaggtaatccatttgtgtctcgcatgcgtaaatcagatt
gtatgtttcccgaagatacttggaaataaatgccatctttcattgattactatcatgaaa
atgaaatctatctccttataagtcaatcaatcgtgccgtcaacatgcggatgggttgatt
gtttttctttgtatccatcatattttttgattcatctcctcttattgaacttgttcttaa
ttataaaatataacaatagaattatttataattattaaatttagatgcattaatattatt
gatattattttcaaaaactagaaatattgatttgttgcatgtataatgttaaaagcgccc
ttttataacgcttacatataaaagcttatttagggagagggatattcaacaagggggatt
tgaaaatgatagaacttaatgcaattacaacattatgtttagcttgtatcctttatttac
ttggtaaggctatcgttaatcacgttaattttttaaaacgtatttgtataccagcaccag
tgattggcggcttaatctttgctattttagttgcggctttggattcatt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search