The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2446: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
Translate Function Assignments



Context on contig NC_007793 from base 2457301 to 2468598 (11298 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2438 2457414 2457301 114 -           FIG01108134: hypothetical protein  
2439 2458426 2457407 1020 - -8         Aldose 1-epimerase (EC 5.1.3.3) gene_name|galM, locus|SAUSA300_2285, protein_id|YP_494920.1, gi|87161694, geneID|3914459
2440 2458782 2458456 327 - 29         Protein of unknown function UPF0060 locus|SAUSA300_2286, protein_id|YP_494921.1, gi|87162407, geneID|3915254
2441 2460232 2459000 1233 - 217         ABC-type Na+ efflux pump, permease component locus|SAUSA300_2287, protein_id|YP_494922.1, gi|87161971, geneID|3914483
2442 2461124 2460225 900 - -8         ABC transporter, ATP-binding protein locus|SAUSA300_2288, protein_id|YP_494923.1, gi|87161206, geneID|3912781
2443 2462002 2461355 648 - 230         FIG01108220: hypothetical protein locus|SAUSA300_2289, protein_id|YP_494924.1, gi|87162419, geneID|3915266
2444 2461994 2462116 123 + -9         Doubtful CDS  
2445 2462170 2462313 144 + 53         Doubtful CDS  
2446 2462401 2463009 609 + 87     1: 13   DNA-3-methyladenine glycosylase II (EC 3.2.2.21) locus|SAUSA300_2290, protein_id|YP_494925.1, gi|87160626, geneID|3915061
2447 2463346 2464554 1209 + 336         Sodium/glutamate symport protein gene_name|gltS, locus|SAUSA300_2291, protein_id|YP_494926.1, gi|87160999, geneID|3913565
2448 2465651 2464602 1050 - 47     4: 2 9 10 14   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2) gene_name|fni, locus|SAUSA300_2292, protein_id|YP_494927.1, gi|87160251, geneID|3915142
2449 2466629 2465682 948 - 30     1: 8   Magnesium and cobalt transport protein CorA gene_name|corA, locus|SAUSA300_2293, protein_id|YP_494928.1, gi|87161343, geneID|3912860
2450 2466726 2467217 492 + 96     7: 12 5 3 7 4 1 11   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) locus|SAUSA300_2294, protein_id|YP_494929.1, gi|87160947, geneID|3913787
2451 2467214 2467633 420 + -4         FIG01107838: hypothetical protein locus|SAUSA300_2295, protein_id|YP_494930.1, gi|87159959, geneID|3913846
2452 2468598 2467741 858 - 107     1: 6   putative esterase locus|SAUSA300_2296, protein_id|YP_494931.1, gi|87162082, geneID|3914625

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA_Repair_Base_Excision VeronikaV DNA-3-methyladenine glycosylase II (EC 3.2.2.21)


  Protein Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
KGNPFVSRMRKSDCMFPEDTWK

MD5 = 716269bd776f3a685d5d248025d4e2fd


  DNA Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
atggatttcgttaataatgatacaagacaaattgctaaaaacttattaggtgtcaaagtg
atttatcaggataccactcaaacgtatacaggctacatcgtggaaacggaagcttactta
ggtttgaatgatcgtgcggctcatggctatggcggtaaaataacacctaaagtcacgtca
ttatataaacgtggtggtacaatttatgcacatgtcatgcatacgcatttactcattaat
tttgtaacaaaatctgaaggtatacctgaaggcgtacttatccgcgcaattgaaccagaa
gaaggtttatccgctatgttccgtaacagaggtaagaaaggctacgaggtaacgaatggc
ccaggaaaatggactaaggcatttaacattccacgggctatcgatggcgctacgttaaat
gactgtagattgtctattgatactaagaatcgtaaatatcctaaagatattattgctagt
ccacgaatcggtattccaaataaaggtgattggacacataaatctttacgttacacagtg
aaaggtaatccatttgtgtctcgcatgcgtaaatcagattgtatgtttcccgaagatact
tggaaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2446 DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
ataccaatattcactacgtcttgatctccccttaaaatttacataatttttccaaaataa
aacgaatgatttcataaaacctacttgaggtaattgttccattgtaatctccctttcgtt
aatcatatttatatttttaattattgttaccgttataatttacaagattcattatcaagc
cacttcatttcaatcgtcaatcactttggaaaatgaactttatatttcatcactagtaaa
atgaaaacccgctacaagtacacatctatatggagactcatttgaaagtcaacgcttcgt
taactatactaaaaatatgtcatactgcaatgttcacgtttaaaagagtctcaatctatg
caaataaaatattccataacaaagtatatactttacatttttataattcttaacaatact
attttatcaaacatttaccacaataaaaatatctttttcatttttatttaaattaatcat
ataattgcgaggagaatattatggatttcgttaataatgatacaagacaaattgctaaaa
acttattaggtgtcaaagtgatttatcaggataccactcaaacgtatacaggctacatcg
tggaaacggaagcttacttaggtttgaatgatcgtgcggctcatggctatggcggtaaaa
taacacctaaagtcacgtcattatataaacgtggtggtacaatttatgcacatgtcatgc
atacgcatttactcattaattttgtaacaaaatctgaaggtatacctgaaggcgtactta
tccgcgcaattgaaccagaagaaggtttatccgctatgttccgtaacagaggtaagaaag
gctacgaggtaacgaatggcccaggaaaatggactaaggcatttaacattccacgggcta
tcgatggcgctacgttaaatgactgtagattgtctattgatactaagaatcgtaaatatc
ctaaagatattattgctagtccacgaatcggtattccaaataaaggtgattggacacata
aatctttacgttacacagtgaaaggtaatccatttgtgtctcgcatgcgtaaatcagatt
gtatgtttcccgaagatacttggaaataaatgccatctttcattgattactatcatgaaa
atgaaatctatctccttataagtcaatcaatcgtgccgtcaacatgcggatgggttgatt
gtttttctttgtatccatcatattttttgattcatctcctcttattgaacttgttcttaa
ttataaaatataacaatagaattatttataattattaaatttagatgcattaatattatt
gatattattttcaaaaactagaaatattgatttgttgcatgtataatgttaaaagcgccc
ttttataacgcttacatataaaagcttatttagggagagggatattcaacaagggggatt
tgaaaatgatagaacttaatgcaattacaacattatgtttagcttgtatcctttatttac
ttggtaaggctatcgttaatcacgttaattttttaaaacgtatttgtataccagcaccag
tgattggcggcttaatctttgctattttagttgcggctttggattcatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0003905       F:alkylbase DNA N-glycosylase activity
GO:0006284       P:base-excision repair
cmr|NT01SA2355 Staphylococcus aureus N315     DNA-3-methyladenine glycosylase
cmr|NT02SA2343 Staphylococcus aureus Mu50     DNA-3-methyladenine glycosylase
cmr|NT03SA2440 Staphylococcus aureus MW2     DNA-3-methyladenine glycosylase
cmr|NT05SA2360 Staphylococcus aureus NCTC 8325     3-methyladenine DNA glycosylase
cmr|NT09SA2246 Staphylococcus aureus subsp. aureus MSSA476     DNA-3-methyladenine glycosidase
cmr|SACOL2339 Staphylococcus aureus subsp. aureus COL     DNA-3-methyladenine glycosylase
cmr|SAUSA300_2290 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative 3-methyladenine DNA glycosylase
dbj|BAB43436.1 Staphylococcus aureus subsp. aureus N315     SA2134
dbj|BAB58506.1 Staphylococcus aureus subsp. aureus Mu50     putative 3-methyladenine DNA glycosylate
dbj|BAB96130.1 Staphylococcus aureus subsp. aureus MW2     MW2265
dbj|BAF68517.1 Staphylococcus aureus subsp. aureus str. Newman     3-methyladenine DNA glycosylase
dbj|BAF79211.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG44048.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative 3-methylpurine glycosylase
fig|158878.1.peg.2344 Staphylococcus aureus subsp. aureus Mu50 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|158878.14.peg.2427 Staphylococcus aureus subsp. aureus Mu50 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|158879.1.peg.2219 Staphylococcus aureus subsp. aureus N315 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|158879.11.peg.2318 Staphylococcus aureus subsp. aureus N315 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|196620.1.peg.2265 Staphylococcus aureus subsp. aureus MW2 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|196620.5.peg.2342 Staphylococcus aureus subsp. aureus MW2 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|282459.1.peg.2214 Staphylococcus aureus subsp. aureus MSSA476 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|282459.5.peg.2325 Staphylococcus aureus subsp. aureus MSSA476 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|359786.13.peg.2508 Staphylococcus aureus subsp. aureus JH9 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|359786.3.peg.1389 Staphylococcus aureus subsp. aureus JH9 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|359787.11.peg.2470 Staphylococcus aureus subsp. aureus JH1 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|359787.3.peg.1860 Staphylococcus aureus subsp. aureus JH1 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|367830.3.peg.2578 Staphylococcus aureus subsp. aureus USA300 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|418127.4.peg.2149 Staphylococcus aureus subsp. aureus Mu3 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|418127.6.peg.2391 Staphylococcus aureus subsp. aureus Mu3 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|426430.6.peg.2174 Staphylococcus aureus subsp. aureus str. Newman FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|426430.8.peg.2443 Staphylococcus aureus subsp. aureus str. Newman FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|451516.9.peg.2435 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|452948.4.peg.1213 Staphylococcus aureus 930918-3 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|455227.3.peg.1847 Staphylococcus aureus D30 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|505321.3.peg.130 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553565.3.peg.2057 Staphylococcus aureus A5937 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553567.3.peg.2264 Staphylococcus aureus A5948 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553568.3.peg.2676 Staphylococcus aureus A6224 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553571.3.peg.1581 Staphylococcus aureus A6300 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553573.3.peg.737 Staphylococcus aureus A8115 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553574.3.peg.1134 Staphylococcus aureus A8117 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553577.3.peg.173 Staphylococcus aureus A8796 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553580.3.peg.175 Staphylococcus aureus A8819 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553581.3.peg.2547 Staphylococcus aureus A9299 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553588.3.peg.2637 Staphylococcus aureus A9719 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553590.4.peg.949 Staphylococcus aureus A9754 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553592.3.peg.997 Staphylococcus aureus A9763 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553594.3.peg.2101 Staphylococcus aureus A9765 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553596.3.peg.1593 Staphylococcus aureus A9781 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|553601.3.peg.575 Staphylococcus aureus A10102 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|585891.3.peg.2423 Staphylococcus aureus subsp. aureus Mu50-omega FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|644279.4.peg.2487 Staphylococcus aureus subsp. aureus 132 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|680649.3.peg.765 Staphylococcus aureus subsp. aureus MR1 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|681288.4.peg.2372 Staphylococcus aureus subsp. aureus ED98 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|703339.3.peg.2333 Staphylococcus aureus 04-02981 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|762962.3.peg.2166 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|93061.3.peg.2474 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|93061.5.peg.2370 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|93062.19.peg.2284 Staphylococcus aureus subsp. aureus COL FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
fig|93062.4.peg.2399 Staphylococcus aureus subsp. aureus COL FIG   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)
gb|AAW37167.1 Staphylococcus aureus subsp. aureus COL     DNA-3-methyladenine glycosylase
gb|ABD21114.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative 3-methyladenine DNA glycosylase
gb|ABD31630.1 Staphylococcus aureus subsp. aureus NCTC 8325     DNA-3-methyladenine glycosylase, putative
gb|ABQ50148.1 Staphylococcus aureus subsp. aureus JH9     DNA-3-methyladenine glycosylase
gb|ABR53239.1 Staphylococcus aureus subsp. aureus JH1     DNA-3-methyladenine glycosylase
gb|ABX30317.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     DNA-3-methyladenine glycosylase
gb|EEV26998.1 Staphylococcus aureus A9781     3-methyladenine DNA glycosylase
gb|EEV64853.1 Staphylococcus aureus A9763     3-methyladenine DNA glycosylase
gb|EEV66174.1 Staphylococcus aureus A9719     3-methyladenine DNA glycosylase
gb|EEV71476.1 Staphylococcus aureus A9299     DNA-3-methyladenine glycosylase
gb|EEV75800.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77571.1 Staphylococcus aureus A6300     DNA-3-methyladenine glycosylase
gb|EEV79329.1 Staphylococcus aureus A6224     DNA-3-methyladenine glycosylase
gb|EEV82384.1 Staphylococcus aureus A5948     DNA-3-methyladenine glycosylase
gb|EEV85275.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45025.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1556
gb|EEW46691.1 Staphylococcus aureus D30     hypothetical protein SAD30_0152
gi|119361060 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|119361061 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|13702144 Staphylococcus aureus subsp. aureus N315 NCBI   SA2134
gi|14248118 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative 3-methyladenine DNA glycosylate
gi|147741850 Staphylococcus aureus subsp. aureus JH9 NCBI   DNA-3-methyladenine glycosylase
gi|148268781 Staphylococcus aureus subsp. aureus JH9 NCBI   DNA-3-methyladenine glycosylase
gi|149947303 Staphylococcus aureus subsp. aureus JH1 NCBI   DNA-3-methyladenine glycosylase
gi|150375257 Staphylococcus aureus subsp. aureus str. Newman NCBI   3-methyladenine DNA glycosylase
gi|150394851 Staphylococcus aureus subsp. aureus JH1 NCBI   DNA-3-methyladenine glycosylase
gi|151222457 Staphylococcus aureus subsp. aureus str. Newman NCBI   3-methyladenine DNA glycosylase
gi|156722794 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980659 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2328
gi|15925334 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative 3-methyladenine DNA glycosylate
gi|15927924 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2134
gi|160369346 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   DNA-3-methyladenine glycosylase
gi|161510537 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   DNA-3-methyladenine glycosylase
gi|166198269 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|189027516 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|189027517 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|189027518 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|205830903 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|21205437 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2265
gi|21283994 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2265
gi|253314684 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative 3-methyladenine DNA glycosylase
gi|255007120 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   putative 3-methyladenine DNA glycosylase
gi|257788658 Staphylococcus aureus A9781 NCBI   3-methyladenine DNA glycosylase
gi|257794686 Staphylococcus aureus A9781 NCBI   3-methyladenine DNA glycosylase
gi|257840393 Staphylococcus aureus A9763 NCBI   3-methyladenine DNA glycosylase
gi|257841737 Staphylococcus aureus A9719 NCBI   3-methyladenine DNA glycosylase
gi|257847474 Staphylococcus aureus A9299 NCBI   DNA-3-methyladenine glycosylase
gi|257851866 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854623 Staphylococcus aureus A6300 NCBI   DNA-3-methyladenine glycosylase
gi|257856420 Staphylococcus aureus A6224 NCBI   DNA-3-methyladenine glycosylase
gi|257859532 Staphylococcus aureus A5948 NCBI   DNA-3-methyladenine glycosylase
gi|257862507 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408710 Staphylococcus aureus A9763 NCBI   3-methyladenine DNA glycosylase
gi|258422306 Staphylococcus aureus A9719 NCBI   3-methyladenine DNA glycosylase
gi|258439698 Staphylococcus aureus A9299 NCBI   DNA-3-methyladenine glycosylase
gi|258442745 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446555 Staphylococcus aureus A6300 NCBI   DNA-3-methyladenine glycosylase
gi|258450328 Staphylococcus aureus A6224 NCBI   DNA-3-methyladenine glycosylase
gi|258452769 Staphylococcus aureus A5948 NCBI   DNA-3-methyladenine glycosylase
gi|258455296 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259159990 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1556
gi|259162113 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0152
gi|49245570 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative 3-methylpurine glycosylase
gi|49487127 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative 3-methylpurine glycosylase
gi|54036660 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|54036661 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|54040710 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|57285073 Staphylococcus aureus subsp. aureus COL NCBI   DNA-3-methyladenine glycosylase
gi|57650887 Staphylococcus aureus subsp. aureus COL NCBI   DNA-3-methyladenine glycosylase
gi|81648752 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|81693874 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative 3-methyladenine DNA glycosylase
gi|87126600 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative 3-methyladenine DNA glycosylase
gi|87160626 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative 3-methyladenine DNA glycosylase
gi|87203820 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   DNA-3-methyladenine glycosylase, putative
gi|88196262 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   DNA-3-methyladenine glycosylase, putative
img|637093887 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100901 Staphylococcus aureus aureus Mu50 IMG   putative 3-methyladenine DNA glycosylate
img|637153098 Staphylococcus aureus aureus COL IMG   DNA-3-methyladenine glycosylase( EC:3.2.2.- )
img|637158505 Staphylococcus aureus aureus MSSA476 IMG   putative 3-methylpurine glycosylase
img|637300082 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888933 Staphylococcus aureus aureus USA300 IMG   putative 3-methyladenine DNA glycosylase
img|637895231 Staphylococcus aureus aureus NCTC 8325 IMG   DNA-3-methyladenine glycosylase, putative( EC:3.2.2.- )
img|639109164 Staphylococcus aureus aureus JH1 IMG   Methylpurine-DNA glycosylase (MPG)
img|640566756 Staphylococcus aureus aureus JH9 IMG   DNA-3-methyladenine glycosylase
img|640780526 Staphylococcus aureus aureus JH1 IMG   DNA-3-methyladenine glycosylase
img|640796676 Staphylococcus aureus aureus Newman IMG   3-methyladenine DNA glycosylase
img|640905126 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310331 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   DNA-3-methyladenine glycosylase( EC:3.2.2.- )
img|641773172 Staphylococcus aureus aureus USA300_TCH959 IMG   DNA-3-methyladenine glycosylase
kegg|saa:SAUSA300_2290 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative 3-methyladenine DNA glycosylase
kegg|sac:SACOL2339 Staphylococcus aureus subsp. aureus COL KEGG   DNA-3-methyladenine glycosylase (EC:3.2.2.-)
kegg|sae:NWMN_2245 Staphylococcus aureus subsp. aureus Newman KEGG   3-methyladenine DNA glycosylase
kegg|sah:SaurJH1_2414 Staphylococcus aureus subsp. aureus JH1 KEGG   DNA-3-methyladenine glycosylase
kegg|saj:SaurJH9_2368 Staphylococcus aureus subsp. aureus JH9 KEGG   DNA-3-methyladenine glycosylase
kegg|sam:MW2265 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02621 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   DNA-3-methyladenine glycosylase, putative (EC:3.2.2.-)
kegg|sas:SAS2235   KEGG   putative 3-methylpurine glycosylase
kegg|sau:SA2134   KEGG   hypothetical protein
kegg|sav:SAV2344   KEGG   putative 3-methyladenine DNA glycosylate
kegg|saw:SAHV_2328 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2325 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   DNA-3-methyladenine glycosylase (EC:3.2.2.-)
ref|NP_372868.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   putative 3-methyladenine DNA glycosylate
ref|NP_375457.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2134
ref|NP_647082.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2265
ref|YP_001247724.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   DNA-3-methyladenine glycosylase
ref|YP_001317526.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   DNA-3-methyladenine glycosylase
ref|YP_001333279.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   3-methyladenine DNA glycosylase
ref|YP_001442918.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2328
ref|YP_001576196.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   DNA-3-methyladenine glycosylase
ref|YP_044348.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative 3-methylpurine glycosylase
ref|YP_187145.1 Staphylococcus aureus subsp. aureus COL RefSeq   DNA-3-methyladenine glycosylase
ref|YP_494925.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative 3-methyladenine DNA glycosylase
ref|YP_501082.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   DNA-3-methyladenine glycosylase, putative
ref|ZP_04837897.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative 3-methyladenine DNA glycosylase
ref|ZP_05145721.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   putative 3-methyladenine DNA glycosylase
ref|ZP_05643665.1 Staphylococcus aureus A9781 RefSeq   3-methyladenine DNA glycosylase
ref|ZP_05680994.1 Staphylococcus aureus A9763 RefSeq   3-methyladenine DNA glycosylase
ref|ZP_05685218.1 Staphylococcus aureus A9719 RefSeq   3-methyladenine DNA glycosylase
ref|ZP_05690444.1 Staphylococcus aureus A9299 RefSeq   DNA-3-methyladenine glycosylase
ref|ZP_05691305.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694710.1 Staphylococcus aureus A6300 RefSeq   DNA-3-methyladenine glycosylase
ref|ZP_05698420.1 Staphylococcus aureus A6224 RefSeq   DNA-3-methyladenine glycosylase
ref|ZP_05700765.1 Staphylococcus aureus A5948 RefSeq   DNA-3-methyladenine glycosylase
ref|ZP_05703256.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
sp|3MGH_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|3MGH_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative 3-methyladenine DNA glycosylase
sp|A5IVC5 Staphylococcus aureus (strain JH9) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|A6QJI5 Staphylococcus aureus (strain Newman) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|A6U471 Staphylococcus aureus (strain JH1) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|A7X5V7 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|A8Z534 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|P65414 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|P65415 Staphylococcus aureus (strain N315) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|P65416 Staphylococcus aureus (strain MW2) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|Q2FEF3 Staphylococcus aureus (strain USA300) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|Q2FVS1 Staphylococcus aureus (strain NCTC 8325) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|Q5HDL2 Staphylococcus aureus (strain COL) SwissProt   Putative 3-methyladenine DNA glycosylase
sp|Q6G6X6 Staphylococcus aureus (strain MSSA476) SwissProt   Putative 3-methyladenine DNA glycosylase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search