The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445972.6.peg.1970: Anaerotruncus colihominis DSM 17241

This feature in The SEED Viewer

NCBI Taxonomy Id: 445972

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_DS544183 from base 48571 to 60248 (11678 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1965 48571 49317 747 +           Phage antirepressor protein locus|ANACOL_01862, protein_id|ZP_02442570.1, gi|167770517
1966 49596 49474 123 - 156     1: 1   hypothetical protein locus|ANACOL_01863, protein_id|ZP_02442571.1, gi|167770518
1967 50169 52313 2145 + 572     1: 1   hypothetical protein locus|ANACOL_01865, protein_id|ZP_02442573.1, gi|167770520
1968 52674 52495 180 - 181     1: 1   hypothetical protein  
1969 52735 54207 1473 + 60     1: 1   hypothetical protein locus|ANACOL_01867, protein_id|ZP_02442575.1, gi|167770522
1970 54218 55030 813 + 10     1: 1   hypothetical protein locus|ANACOL_01868, protein_id|ZP_02442576.1, gi|167770523
1971 55521 56390 870 + 490     1: 1   hypothetical protein locus|ANACOL_01870, protein_id|ZP_02442578.1, gi|167770525
1972 56402 56893 492 + 11     1: 1   hypothetical protein locus|ANACOL_01871, protein_id|ZP_02442579.1, gi|167770526
1973 56874 57011 138 + -20     1: 1   hypothetical protein locus|ANACOL_01872, protein_id|ZP_02442580.1, gi|167770527
1974 57063 57413 351 + 51     1: 1   hypothetical protein locus|ANACOL_01873, protein_id|ZP_02442581.1, gi|167770528
1975 57430 57708 279 + 16     1: 1   Phage holin locus|ANACOL_01874, protein_id|ZP_02442582.1, gi|167770529, InterPro:IPR006485
1976 57723 58496 774 + 14     1: 1   hypothetical protein locus|ANACOL_01875, protein_id|ZP_02442583.1, gi|167770530, InterPro:IPR002053, InterPro:IPR013781
1977 59423 59536 114 + 926     1: 1   hypothetical protein  
1978 59536 59997 462 + -1     1: 1   hypothetical protein locus|ANACOL_01878, protein_id|ZP_02442586.1, gi|167770533
1979 59997 60248 252 + -1     1: 1   hypothetical protein locus|ANACOL_01879, protein_id|ZP_02442587.1, gi|167770534

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|445972.6.peg.1970 hypothetical protein
MAELNLGRVVGQDGERGEPGKSAYAYAQEAGFVGTEQEFSSNLAGINEKANKAPDAVEGN
IAILDAEGNPTDSGKNLDEVGGKVPIVSSPPSDDKITFWLNTETPVEDIPAIDPPGAAEK
ALEDAKKYTNEYAPAKPQAVQGNLLIAGENGKLEDSGIAREQVSALFQSEPLIFLNGWED
NGGSKIAFTENLITLYIRARGTQLEFNTVIARSPQIPIKQVVFTGIVSSLDSLEKSPLIL
VLELNGNIRVGASGRPNEASDLWVSSTAIQ

MD5 = 8a0b63de3247e38df7379432bba84416


  DNA Sequence

>fig|445972.6.peg.1970 hypothetical protein
atggcagagttaaatttgggcagggttgtaggtcaagatggggagcgcggtgaaccggga
aagtctgcctatgcatatgctcaagaggctggatttgtcggtacagagcaggagttttct
tcaaatttagctggcattaatgaaaaggcaaataaggcccccgacgcagtggaaggcaat
attgcgatcttagatgcggagggcaatccaacagacagcgggaaaaatttggacgaggtt
ggcggaaaggtccccattgtatcgtctccgccaagcgatgacaagattacattttggcta
aataccgaaacgccggttgaggacatcccggctatagatccgccgggcgccgctgaaaaa
gctctggaggacgcgaaaaaatatacaaatgaatatgctcctgcaaaaccgcaagccgta
caagggaatcttttgatagccggagaaaatggaaaacttgaagatagcggtattgcacgg
gaacaagtatcggcattatttcaatcagagcccttgatattcttaaacggttgggaagac
aatggcggctccaaaatagcttttactgaaaacttgataactctatatatacgcgcaaga
ggaacacaattggaatttaatacagttatcgcaagatcccctcaaattccaattaaacag
gtagtttttactgggatagtaagttcgcttgattcactagaaaaaagcccactaatactt
gttttggagctaaatggaaatataagggttggcgcatcaggaaggccaaatgaagcttca
gatctgtgggttagttcaacagctattcaatga


  DNA with Flanking Sequence

>fig|445972.6.peg.1970 hypothetical protein
aaggatcaaaggagaaattgacgggatacaagatgactttcggcaggaaagcgatcagaa
actttctgaaatggaaagtttgcgggatgaaacacaagcgatcaaagatagtaccgcagt
gaatgtcagtattgattccagtgaagataccggatatcgtgtaggatttaaacgggcaga
tcaatcagaaccggtatggacaccgcccctgcaagcgaaggttaatgcgggtacgattac
catgttagagcctgacgacctgccgacgatcacgcagcgaggaccggccagcaatcggac
ttttgattttgccattccacgcggacagaggggcgagccaggcagggatggagtgagcgt
atcaatagaaaacggaatgtatgcatttgaaattcgagatggatatctaatgctgctata
tccgaataatactgatccgccgcccttgaagattaatacaagcggagagcttatttatac
gatttcatgaggtggtttttatggcagagttaaatttgggcagggttgtaggtcaagatg
gggagcgcggtgaaccgggaaagtctgcctatgcatatgctcaagaggctggatttgtcg
gtacagagcaggagttttcttcaaatttagctggcattaatgaaaaggcaaataaggccc
ccgacgcagtggaaggcaatattgcgatcttagatgcggagggcaatccaacagacagcg
ggaaaaatttggacgaggttggcggaaaggtccccattgtatcgtctccgccaagcgatg
acaagattacattttggctaaataccgaaacgccggttgaggacatcccggctatagatc
cgccgggcgccgctgaaaaagctctggaggacgcgaaaaaatatacaaatgaatatgctc
ctgcaaaaccgcaagccgtacaagggaatcttttgatagccggagaaaatggaaaacttg
aagatagcggtattgcacgggaacaagtatcggcattatttcaatcagagcccttgatat
tcttaaacggttgggaagacaatggcggctccaaaatagcttttactgaaaacttgataa
ctctatatatacgcgcaagaggaacacaattggaatttaatacagttatcgcaagatccc
ctcaaattccaattaaacaggtagtttttactgggatagtaagttcgcttgattcactag
aaaaaagcccactaatacttgttttggagctaaatggaaatataagggttggcgcatcag
gaaggccaaatgaagcttcagatctgtgggttagttcaacagctattcaatgacgggggg
atgtaagcatggacagtctggagaaagcgttattgcaggtgaagatcccaatccaggaaa
aaaataattgctttttaagcgatgaaggttttttatttacgcctttgaaaatcaatggag
ttgttgtaaaaaccggaaatgaagtgtatcaagaatggctaaatctgaaaaatgaagcca
tcataggattaaatttgacagacgcctgggaacagataccgggaaacatatctggaatat
cgcaaattggaaatttggcgcaaataaatgcaaatataaaaagcaaaagagagatcggcg
cagggaaaattattttaaatctcccgattaagccaatttccatgcaatacccaactgttt
ctgtggatgaagggcaataccggttacagttaagtccggacggcacattaataacaactg
aaataatcccgataggcacaagccttcacttggatttttcttatatcagtaaagaggtgt
aaaatgcaggata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EDS11248.1 Anaerotruncus colihominis DSM 17241     hypothetical protein ANACOL_01868
gi|167667118 Anaerotruncus colihominis DSM 17241 NCBI   hypothetical protein ANACOL_01868
gi|167770523 Anaerotruncus colihominis DSM 17241 NCBI   hypothetical protein ANACOL_01868
img|642205266 Anaerotruncus colihominis DSM 17241 IMG   hypothetical protein
ref|ZP_02442576.1 Anaerotruncus colihominis DSM 17241 RefSeq   hypothetical protein ANACOL_01868
tr|B0PAR8 Anaerotruncus colihominis DSM 17241 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search