The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445972.6.peg.1965: Anaerotruncus colihominis DSM 17241

This feature in The SEED Viewer

NCBI Taxonomy Id: 445972

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_DS544183 from base 40089 to 55030 (14942 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1961 40089 44543 4455 +       1: 1   Phage tail, tail length tape-measure protein locus|ANACOL_01854, protein_id|ZP_02442562.1, gi|167770509
1962 45146 45012 135 - 468     1: 1   hypothetical protein locus|ANACOL_01855, protein_id|ZP_02442563.1, gi|167770510, InterPro:IPR007829
1963 45554 46489 936 + 407     1: 1   hypothetical protein locus|ANACOL_01856, protein_id|ZP_02442564.1, gi|167770511
1964 47274 46990 285 - 500     1: 1   hypothetical protein locus|ANACOL_01858, protein_id|ZP_02442566.1, gi|167770513
1965 48571 49317 747 + 1296         Phage antirepressor protein locus|ANACOL_01862, protein_id|ZP_02442570.1, gi|167770517
1966 49596 49474 123 - 156     1: 1   hypothetical protein locus|ANACOL_01863, protein_id|ZP_02442571.1, gi|167770518
1967 50169 52313 2145 + 572     1: 1   hypothetical protein locus|ANACOL_01865, protein_id|ZP_02442573.1, gi|167770520
1968 52674 52495 180 - 181     1: 1   hypothetical protein  
1969 52735 54207 1473 + 60     1: 1   hypothetical protein locus|ANACOL_01867, protein_id|ZP_02442575.1, gi|167770522
1970 54218 55030 813 + 10     1: 1   hypothetical protein locus|ANACOL_01868, protein_id|ZP_02442576.1, gi|167770523

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|445972.6.peg.1965 Phage antirepressor protein
MNDIMKIDGIECYEKDGTAYLKLEAVARGLGFTETKDSKDYVMWRRVDGYLANLGFGTSA
ERPDFIPENVFYRLAMKAKNEAAEAFQAKIADEVIPAIRKHGAYMTPETLEAAIMNPDIM
IRLCTALKNEQEKRKALETVNSALTVDNQIMRPKADYFDELVDRNLLTNFRETAKQLEIK
EKNFIGFLLEKKYIYRDKRGKLLPYADKNNGLFEVKECFNEKTQWSGTQTLVTPKGRETF
RLLYLRNK

MD5 = 645380c46b6bcc493a7558fbb9dcf8e0


  DNA Sequence

>fig|445972.6.peg.1965 Phage antirepressor protein
atgaatgacattatgaaaattgacggaatcgagtgctacgagaaggacggtacagcttat
ttgaagctggaggctgtcgcgcgtgggttgggttttaccgaaacaaaagacagtaaggat
tatgtgatgtggcgcagggtagacggatatcttgcaaatcttggtttcggcacttctgcc
gaaaggcccgatttcatccctgaaaatgtcttttacaggctggccatgaaggctaagaac
gaagcggccgaagcgttccaggctaagatcgcggacgaagtcatccccgccatccgtaaa
cacggcgcgtatatgacgcccgagacactggaggcggcgatcatgaacccggatatcatg
atcaggttatgcaccgcactcaagaatgaacaggagaagcgcaaagcccttgaaacagta
aattctgccctgacggtcgacaaccagatcatgcggcccaaagcggactatttcgacgaa
cttgtggaccgtaatctgttgacaaattttcgcgagacggcaaaacaactggagatcaag
gaaaagaatttcattggatttttgttggaaaagaagtatatataccgggataagcgcgga
aaactactgccctatgcggataaaaacaacgggctgtttgaggttaaggagtgtttcaac
gagaaaacacaatggagcggtacgcagacattggtcacgcccaaaggccgggagacattt
cgtttgctatatttaaggaataagtag


  DNA with Flanking Sequence

>fig|445972.6.peg.1965 Phage antirepressor protein
gggatttgttcagttatggcagatgcgattttagaagggccaaacatacccgataagggt
tgtgggaacgggttgtggctgatcgcaagtgttttggataagcatcaaaaaaatatggag
gaagtaatagatgtgctccatcaacagaatagggaaggggctgcatgaatcagatcaagg
taaaaattgcttggctgcgagatttggccggttctaatggaaatgtaaaaaaacagagga
gaacgcgtaacacggtcaaaaattcacaaaaaagttgcacaaatttttcagacaaataag
ggatacgtttggttttgtaaattagtgtgttaaatcatttcaggcgtcagactgtttcag
tagtgtttgaaactgtttcagtattgaggaatattcattggagttcgtcaaaatgccgaa
aagcacttttgacaaaaaaggattaagtatccataatgaatacagtgaagcgcgcggaaa
ctgatgaaaggagaatgcaaatgaatgacattatgaaaattgacggaatcgagtgctacg
agaaggacggtacagcttatttgaagctggaggctgtcgcgcgtgggttgggttttaccg
aaacaaaagacagtaaggattatgtgatgtggcgcagggtagacggatatcttgcaaatc
ttggtttcggcacttctgccgaaaggcccgatttcatccctgaaaatgtcttttacaggc
tggccatgaaggctaagaacgaagcggccgaagcgttccaggctaagatcgcggacgaag
tcatccccgccatccgtaaacacggcgcgtatatgacgcccgagacactggaggcggcga
tcatgaacccggatatcatgatcaggttatgcaccgcactcaagaatgaacaggagaagc
gcaaagcccttgaaacagtaaattctgccctgacggtcgacaaccagatcatgcggccca
aagcggactatttcgacgaacttgtggaccgtaatctgttgacaaattttcgcgagacgg
caaaacaactggagatcaaggaaaagaatttcattggatttttgttggaaaagaagtata
tataccgggataagcgcggaaaactactgccctatgcggataaaaacaacgggctgtttg
aggttaaggagtgtttcaacgagaaaacacaatggagcggtacgcagacattggtcacgc
ccaaaggccgggagacatttcgtttgctatatttaaggaataagtagaattagttcgtat
tgttttctccgaaaagaagccagacggatttttcctgtttggcttctttttttgttataa
atggccggttcccaattcacaaaatacttatgtaaacatcttgcgagattggaaaaaatg
tgatattgttatattgtgatctattacagcagattagccgcgtctttgtagtccttataa
tttatgccgaacgtatcgtggaaacttgcgaagcccgcgatctgagaagaagtcggacgg
attgtacccgtttggctttttttcattattttcttgaaaaatacaggccgatgtgatatt
atagatacaataacaatgagccttgagccaatcagttgagaaagactgattggctttttg
cattttctaatataattgaaaattttgagcctttgagccgatattctgcattttgcgggg
tgttggctcttttttgctttgagggagggaaacgaaaaatggaattacccctgtccaacg
tttggaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search