The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445972.6.peg.1963: Anaerotruncus colihominis DSM 17241

This feature in The SEED Viewer

NCBI Taxonomy Id: 445972

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_DS544183 from base 40089 to 52313 (12225 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1961 40089 44543 4455 +       1: 1   Phage tail, tail length tape-measure protein locus|ANACOL_01854, protein_id|ZP_02442562.1, gi|167770509
1962 45146 45012 135 - 468     1: 1   hypothetical protein locus|ANACOL_01855, protein_id|ZP_02442563.1, gi|167770510, InterPro:IPR007829
1963 45554 46489 936 + 407     1: 1   hypothetical protein locus|ANACOL_01856, protein_id|ZP_02442564.1, gi|167770511
1964 47274 46990 285 - 500     1: 1   hypothetical protein locus|ANACOL_01858, protein_id|ZP_02442566.1, gi|167770513
1965 48571 49317 747 + 1296         Phage antirepressor protein locus|ANACOL_01862, protein_id|ZP_02442570.1, gi|167770517
1966 49596 49474 123 - 156     1: 1   hypothetical protein locus|ANACOL_01863, protein_id|ZP_02442571.1, gi|167770518
1967 50169 52313 2145 + 572     1: 1   hypothetical protein locus|ANACOL_01865, protein_id|ZP_02442573.1, gi|167770520

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|445972.6.peg.1963 hypothetical protein
MKKVICCLTSIMLIGFAGCANDTNQTHEETSSSNYGQVTTQSSEITASGSLEAQEPAQTS
QESGEVIINEQVLVDENGIKITATGFDEGGIFGPGIKLLIENNTDTDLTVQARNASVNGY
MIDTSISAEVVAGKKANDTIDFMESDLETCGITTLADFEFSFHIFSTDDWQEYLDTPIVQ
VKNASVDSYNYEYDDTGTLLYEGEGIRIISKGMAEEGSFLGPNLKLFIENLSQQGITVQA
RDVSVNGFMVDTSLSAEVLPNKRANTELTLIESDLEENGIAAVNEIELSFHIFESESWND
IIDTEKITITF

MD5 = e89e86152edb4b3c460dab0f875c1d05


  DNA Sequence

>fig|445972.6.peg.1963 hypothetical protein
atgaaaaaagtgatatgttgtctaacctcaattatgttaatcggatttgctggctgtgcc
aatgatacaaatcaaacccatgaagaaacaagcagtagtaactatggacaggttacaaca
caatccagtgaaataactgcatctggttcccttgaggcacaagaaccggcccaaacttcg
caagaaagcggagaggtgattatcaatgagcaggtgcttgttgacgagaatgggattaaa
attacagcaacaggatttgatgaaggtggaatatttggtcctggaattaaactgttaatc
gaaaataatacagatacggatttaactgtacaagcaaggaatgcgtctgttaatggatat
atgattgatacatccatttcggcggaagttgttgcaggcaaaaaggcgaatgatacaatt
gactttatggagtctgatcttgaaacatgcgggattacaacattggctgattttgaattc
tcttttcatattttttcaactgacgattggcaggagtatttggatacaccgatcgtccag
gtgaaaaatgcgagtgtagattcatataattatgaatacgatgatacgggtacccttctt
tatgaaggtgaaggaattcgtataatttccaagggcatggcagaagaaggatctttcctt
ggcccaaatctcaaactgtttatagaaaatctaagccaacagggaataactgttcaagcc
cgtgacgtttcagtgaacggattcatggttgatacatcactttccgcagaggtacttcct
aataaacgagctaatacagaattaaccttgatagagtctgatttagaggaaaatggaatt
gcagcagtaaacgaaattgaattgtcttttcacatctttgaatcggaaagctggaatgac
attattgatacagagaaaataacgattacattctaa


  DNA with Flanking Sequence

>fig|445972.6.peg.1963 hypothetical protein
atcgatcagccatccaatacctaaaagaccgcctgtacataaataaacaattccaagtaa
aattttgccttcataaaatttatgcacgcccaaaatgccaaggaaaagacaaaggaaaaa
cgcgacccatttattttttgcttttacacttggaccggatgcagttactgtattcgtatt
tgtattcgtgttatttataataattgttggcggttgtggagcggcttgatttgctgatgc
agtagtaactgaaatatcttgatcctgcgacatgggagttccacaagaaggacaaaactt
tcccgttgattctgtgccgcatttaggacaaagcattttctattcctccaatcaataacc
attatcttttaaactttttcaatattatacaatatatttatactgatgtctactaaaatt
tggttttatcttgacaatatacactataaaaagtataattttggtgctaaaggtaaattt
taaatggtggaggaaagagaatgaaaaaagtgatatgttgtctaacctcaattatgttaa
tcggatttgctggctgtgccaatgatacaaatcaaacccatgaagaaacaagcagtagta
actatggacaggttacaacacaatccagtgaaataactgcatctggttcccttgaggcac
aagaaccggcccaaacttcgcaagaaagcggagaggtgattatcaatgagcaggtgcttg
ttgacgagaatgggattaaaattacagcaacaggatttgatgaaggtggaatatttggtc
ctggaattaaactgttaatcgaaaataatacagatacggatttaactgtacaagcaagga
atgcgtctgttaatggatatatgattgatacatccatttcggcggaagttgttgcaggca
aaaaggcgaatgatacaattgactttatggagtctgatcttgaaacatgcgggattacaa
cattggctgattttgaattctcttttcatattttttcaactgacgattggcaggagtatt
tggatacaccgatcgtccaggtgaaaaatgcgagtgtagattcatataattatgaatacg
atgatacgggtacccttctttatgaaggtgaaggaattcgtataatttccaagggcatgg
cagaagaaggatctttccttggcccaaatctcaaactgtttatagaaaatctaagccaac
agggaataactgttcaagcccgtgacgtttcagtgaacggattcatggttgatacatcac
tttccgcagaggtacttcctaataaacgagctaatacagaattaaccttgatagagtctg
atttagaggaaaatggaattgcagcagtaaacgaaattgaattgtcttttcacatctttg
aatcggaaagctggaatgacattattgatacagagaaaataacgattacattctaatact
tggactgaaattgaaaagggccgggaaagctttcccggcccttttctctatttattattt
acacttggtttgtttgatccgtctcgtcatctttagaaggctggacggcaaaaaacggcg
tcaacaattgggcagtcgaaatgccagtagcttgactaaggcgatcaagaattttaaggt
tagtatgaacttctgctcgctcgattttcgcatagcttttaacactagtcttgatgcgga
atgctaattcctcttgactgatatcattgattgtgcgatattccaaaaggttgcacgcca
aaatgaccctagattcatcgtacttcataattatttcctcccgcctcgttatatgacgat
ttatggaaataattgtataaattagtcgtattttggcgcaagagcgataagacccttgac
aaacttttttaactgtacagttaaaaacacaaaacagggtggcgcacgccaccctgtaaa
tctgatgtcttgttta


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search