The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445972.6.peg.1961: Anaerotruncus colihominis DSM 17241

This feature in The SEED Viewer

NCBI Taxonomy Id: 445972

Current Assignment: Phage tail, tail length tape-measure protein
Translate Function Assignments



Context on contig NZ_DS544183 from base 35254 to 49596 (14343 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1951 35254 35931 678 +       1: 1   hypothetical protein locus|ANACOL_01844, protein_id|ZP_02442552.1, gi|167770499
1952 35943 36881 939 + 11         Phage mv4 gp34 protein homolog locus|ANACOL_01845, protein_id|ZP_02442553.1, gi|167770500
1953 36911 37123 213 + 29     1: 1   hypothetical protein locus|ANACOL_01846, protein_id|ZP_02442554.1, gi|167770501
1954 37138 37449 312 + 14     1: 1   Phage capsid and scaffold locus|ANACOL_01847, protein_id|ZP_02442555.1, gi|167770502
1955 37446 37829 384 + -4     1: 1   hypothetical protein locus|ANACOL_01848, protein_id|ZP_02442556.1, gi|167770503
1956 38003 38359 357 + 173     1: 1   Phage capsid and scaffold locus|ANACOL_01849, protein_id|ZP_02442557.1, gi|167770504
1957 38359 38757 399 + -1     1: 1   hypothetical protein locus|ANACOL_01850, protein_id|ZP_02442558.1, gi|167770505
1958 38951 39229 279 + 193     1: 1   hypothetical protein locus|ANACOL_01851, protein_id|ZP_02442559.1, gi|167770506
1959 39250 39744 495 + 20     1: 1   hypothetical protein locus|ANACOL_01852, protein_id|ZP_02442560.1, gi|167770507
1960 39765 40034 270 + 20     1: 1   hypothetical protein locus|ANACOL_01853, protein_id|ZP_02442561.1, gi|167770508
1961 40089 44543 4455 + 54     1: 1   Phage tail, tail length tape-measure protein locus|ANACOL_01854, protein_id|ZP_02442562.1, gi|167770509
1962 45146 45012 135 - 468     1: 1   hypothetical protein locus|ANACOL_01855, protein_id|ZP_02442563.1, gi|167770510, InterPro:IPR007829
1963 45554 46489 936 + 407     1: 1   hypothetical protein locus|ANACOL_01856, protein_id|ZP_02442564.1, gi|167770511
1964 47274 46990 285 - 500     1: 1   hypothetical protein locus|ANACOL_01858, protein_id|ZP_02442566.1, gi|167770513
1965 48571 49317 747 + 1296         Phage antirepressor protein locus|ANACOL_01862, protein_id|ZP_02442570.1, gi|167770517
1966 49596 49474 123 - 156     1: 1   hypothetical protein locus|ANACOL_01863, protein_id|ZP_02442571.1, gi|167770518

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|445972.6.peg.1961 Phage tail, tail length tape-measure protein
MGQAITVEELQIVISAQVKDALQGIQQVMTKLQQMMNVKMPDLQRQMQSITVPMQQASAQ
VRKTTEQSSEAVRKSTEGSKKSLESLYAQLGQLNARLENQRKIYDGLVEKSRSISFKHGD
NSLESARIEKSLLTAAETYDRLKAKSDAVRAAIAKLKEPFEQAALAANKCAVSTEKVTGA
MAGSDPALNKSEQVIRRVQESMENLAKSTEKYKDIGKSSVLSVNNISSGFAETNAPAEQI
GKTLQRIKGTVEQAGRSIEKYGTVEKAVVNKVAGAFEQAAAAADKYTTATEKVAGAVTGA
TAPLNNSEQVIRRVQESMENLAKSTEKYKNIGKLPINDFSGGLAEANAPADQVDKTIQRV
RDGTEQARKSTEKYGKAAKSAASKAAGAFEKLGKVIKNALIIGVFYKSFRSLFKFISDGI
KAAISAPEIENMFNVAFGSMAYQADQFALRLKKAFGVDQIAVKQMLGTFQNFNDSMGIGA
QTAYKMSTTLTQLAYDMASLYEMDVNQVYENLQSGLQGMPRALYKYGIAITDANIRQTAL
RYGIGETGRELTSQEKIIARYITILEQTKNAQGDMARTIESPANQLRILKSQLTAAGRAI
GQAFMPFIQAVLPFLNALAVVLERVGNALARFTFRLFGRDFDAEMKEKQEALKNLGDSTG
SVAGAQEDLADGINDAKKSAKGALAPFDELTVLQKDMADASVPDMSGGAYEFPDLPTLEP
PEGESPYEKMADRILAKFTEIFNEIRTFWDKYFAEPFAQAWAKISPQIEKLKDTFGKIFA
DILTLAQPLTDWFYNNAIPMLQQLVITGGDVLAGLLDSINMVILDIWNALFPMIQAFIEL
ALPAITDFVTESIKTFGTLFDEVKKIFDLIWTGAIKPALDLISQIWQDLMQDIKDLWDKW
GVTTFENIRETIRTISGLFQKTWETVLKPIFDKIFQVLGELWTEHLNPLLVKIGDFVMTL
ANAAMDIYNQFIAPIVGWFIETLGPAISETVNVIIDVVGGLLGAISDVVGSILDVLGGAI
DFIAGVLTGDWDRAWDGLERTFTGAWDGMVKFFSGVWETLTGLFDTLMESAKNAADRVLE
FIGLKEKTKEAADEVGEAITTGTEEGIKKNSNKPQSAAVDMMDQSIKGAKEKAGIHSPST
VFAEIGENLILGLAEGIRNGTSTALSSIQELVNGLRDALQTAFSTMDSMGGEGVEVGIMP
GQGGMFYQFGMQLMQGLSAGITAGQVLVTQAIVAAADTIKTDFKTQFEIEELSGVFTEYG
RTFDESLATGITDNTEFVLEALQGLAETIDEHYAEFMEEFSGTFAEDMDELYETLSDTVS
SMEESVTDATSQMINSISRLISRIEKAIDRLLELYDLGGSFGGGSGRDKDKSKTSGSGER
SISGRTLDIPQLAKGAVLRRPTIVNVAEYAGAMSNPEIVSPRNIMYDTVVEANAPLVSAM
SQIANRIITAIEENQPITEIGDDIIYASAKRGARKYNRMIGSII

MD5 = 61ff1290dec993d4f2cf9179c061b6c7


  DNA Sequence

>fig|445972.6.peg.1961 Phage tail, tail length tape-measure protein
atgggacaggcaattacagttgaagaacttcagatcgtcatttctgcacaggtcaaagat
gcattgcagggaattcagcaggtcatgaccaagctccagcagatgatgaacgtaaaaatg
ccggacttgcagcggcagatgcagagtatcacggtgcccatgcagcaggcatccgcgcag
gtccggaaaacaactgaacagagcagcgaagctgtgcgcaaatcaacagaaggcagcaag
aaaagccttgaaagcctttatgcgcagttgggacaactgaacgcccggttggaaaatcag
cgaaaaatctatgatgggttggttgaaaagtcgcggtccatttcttttaaacatggagat
aacagtcttgagagcgcaaggattgaaaaaagtcttttgactgcggccgagacgtatgat
cgtctaaaagccaaatccgatgcagttcgtgcggccattgcgaaactgaaagaacccttt
gagcaggcggcgttggccgcaaacaagtgcgcggtttcaacggagaaagtcaccggcgct
atggcggggagcgatcctgcgttaaacaaaagcgaacaggttatccggcgcgtacaggaa
agcatggagaatcttgctaaatctacggaaaagtacaaggatattgggaaatcatcagta
ttatcagtcaataacatttcaagtggatttgcagagacgaatgcaccggcagagcagatt
ggaaagacactccaacgtatcaaaggaaccgtagaacaagccgggagatcaattgaaaag
tatggaactgtagaaaaagcagttgtaaacaaagtagcaggcgcttttgaacaagcggca
gcagcagcggataagtatactactgcaacagaaaaagtagcaggcgctgtaactggagca
actgccccattaaataacagcgaacaggttatccggcgcgtacaggaaagcatggagaat
cttgctaaatctacagagaagtacaaaaatattgggaaattaccgattaatgatttttca
ggcggattggcagaagccaatgcgcccgcggatcaagttgataagacaatccaacgtgtc
agggacggtactgaacaggccagaaaatccacggagaaatacgggaaagcggcaaaatct
gccgcgagtaaagcagcgggagcatttgaaaagctgggcaaggtgataaaaaatgccctg
attattggagtgttttacaagtctttccgcagtttgtttaaattcatttcagacggaatt
aaagcagctatttccgcgcctgaaattgaaaatatgttcaacgtggcgtttggaagtatg
gcatatcaggcggatcaatttgcgctgcgtctcaaaaaggcgtttggcgtagatcagatt
gcggttaagcagatgcttggcactttccaaaatttcaatgattcaatgggaattggagcg
cagacagcttataagatgtcaacgactctgacccaattggcctacgatatggcgtcgctc
tatgaaatggacgtcaatcaggtgtatgaaaacctgcaatccgggctgcaaggaatgccg
cgcgcattgtacaaatatggtatcgccatcacagacgcaaatatcaggcaaaccgcgctg
cggtatggaatcggagagactgggcgggaactgacgtcacaggaaaaaattatcgcccga
tacataactattttagaacagaccaagaacgcgcagggagacatggcacgcaccatcgag
tcaccggcgaaccaactgcgcattttaaaaagccagttgacagcggccggccgtgcgatt
ggacaagcgttcatgccgttcattcaagctgttctgccgtttttgaacgcattggcggtt
gtgcttgaacgcgtggggaatgccctggcgcgttttacattccgtttgtttgggcgcgat
tttgacgccgaaatgaaggagaagcaagaagctctgaaaaatttgggcgacagtacggga
agtgtggcaggagcgcaggaggaccttgcagacggcatcaatgatgcgaaaaagtctgcg
aaaggcgcgttggcgccctttgatgaactgaccgtgctgcaaaaagatatggctgatgca
tctgtgccggacatgtcaggcggggcatatgagtttccagatctgcctacgcttgagccg
ccggagggtgaatccccatatgaaaagatggccgatagaatactggcaaagtttacagaa
atatttaatgagatcagaacgttttgggacaaatactttgcagagccttttgcacaggcg
tgggctaaaataagcccgcaaattgaaaagcttaaagacactttcgggaaaatatttgcc
gacattttaacactcgcgcagccattgacagattggttttataataatgcaattccaatg
ttgcagcagttagtaataacaggcggtgatgtgctggcaggtcttttggatagcattaat
atggttattctagacatctggaatgcccttttcccaatgatacaggcatttatagaattg
gcgctgccggccattacagattttgtaacagaatcgataaaaacctttggaactctattc
gatgaagtcaaaaaaatatttgatttaatttggacgggagctataaaacctgcattggac
ttgatctcacaaatttggcaggaccttatgcaggacattaaagatttatgggataagtgg
ggcgtaaccacttttgagaatattcgtgaaacaattcgaaccatatccggattgtttcaa
aaaacttgggaaacggttttaaagcctatctttgataaaatatttcaagtgcttggggaa
ttatggaccgagcatttgaatccattgctggtcaaaattggagattttgtaatgacactc
gcaaatgcggcgatggatatctataaccagttcattgcacccattgtaggatggtttatt
gaaaccctagggcctgcgatttcagaaacggtcaatgtgataatagatgtagtcggggga
cttttaggagcgatttcagatgttgttgggagcattttagatgtattgggtggggccatt
gattttatagcgggagtattaacaggcgattgggatcgtgcatgggatggcttggaaagg
acatttacaggtgcgtgggatggaatggttaaatttttttctggtgtatgggaaacactc
actgggttatttgatactctgatggaatcagcaaaaaatgcagcggatcgtgttcttgaa
tttataggacttaaagaaaagacgaaagaggcagcagatgaagttggagaagcaatcaca
actggaacagaggaggggatcaagaagaattccaacaagccgcaaagtgcggcggttgat
atgatggaccaatcgataaaaggtgccaaagaaaaggctggaattcattcaccatcgaca
gtattcgcagagattggtgaaaatttaattttgggattggcagaaggtatccgaaacggt
acatctacagcactttcatctatccaagagcttgtaaatggcctgcgggacgcgctccaa
acggcattctctacaatggattctatgggcggcgaaggtgttgaggttggtattatgcct
ggacagggcggcatgttctatcagtttggaatgcagctcatgcaaggattgtcagcggga
ataacggctggacaggtgcttgtaacacaggcaattgttgcggccgctgatacaatcaaa
actgattttaagacacaatttgagattgaagaattgtcaggagtgttcacagagtacgga
cggacgtttgatgaaagccttgcaacaggtattaccgataacacagaatttgtcttggaa
gctttacagggccttgccgaaactattgatgaacactatgcggaattcatggaagaattc
agcggtactttcgcggaagatatggacgaattgtatgaaaccttatcggatacggtttcg
agcatggaggaatctgtaactgatgcgacatcacaaatgattaattcaatctcccgcctg
atttcacgcattgaaaaagcgatagaccgtctgttagaactatatgatcttggcggatca
tttggcggcggatcaggtcgggataaagataagtcaaaaacttctggctccggagagcgt
tcgatatcaggtcgcaccttagatattccccagttggcaaaaggagcagttttgcggcgc
ccaacaattgtcaatgtagcagaatatgcaggagctatgagcaatcccgaaatcgtttca
ccgcgtaatattatgtatgatacggttgtagaagctaatgctccattagtatcagccatg
tcgcagatagcgaatcgaattattactgccatagaagaaaatcaaccaataacagaaata
ggggatgatatcatttatgcaagcgccaagcgcggcgcgcgaaaatataaccgcatgatc
ggttcaattatataa


  DNA with Flanking Sequence

>fig|445972.6.peg.1961 Phage tail, tail length tape-measure protein
gatttggccatcgatatggacgcgcttacagcggaggcggttcgcatgttccggggcgag
gctcttgggaagatggtggcggaaatggccggtactattcggactggtgcgaatacatcg
acgatctccgacccgctgcctatgaaagcggaataaaaccgctggaatttgaggccatga
ccgtgcagcaggtcgcggagtaccttgaagcatatagccgcaaacggctggatgatttta
aggaacaggcgatcctgctgcaaggccaggcattccagattacatcaggtattgcgcaat
tgcttgataaaaaagcaaagttccgtggtttggataagatttaccccgaattgtttggaa
agaaaaaaatagatatctccactatgacgccggagcagatagaacgtgcgacagtcaatg
cgtggagtgtatttttaggaatctaagcccctaacagagccttgagccgtggcggattca
taccaggatggtgggcatgtatgggacaggcaattacagttgaagaacttcagatcgtca
tttctgcacaggtcaaagatgcattgcagggaattcagcaggtcatgaccaagctccagc
agatgatgaacgtaaaaatgccggacttgcagcggcagatgcagagtatcacggtgccca
tgcagcaggcatccgcgcaggtccggaaaacaactgaacagagcagcgaagctgtgcgca
aatcaacagaaggcagcaagaaaagccttgaaagcctttatgcgcagttgggacaactga
acgcccggttggaaaatcagcgaaaaatctatgatgggttggttgaaaagtcgcggtcca
tttcttttaaacatggagataacagtcttgagagcgcaaggattgaaaaaagtcttttga
ctgcggccgagacgtatgatcgtctaaaagccaaatccgatgcagttcgtgcggccattg
cgaaactgaaagaaccctttgagcaggcggcgttggccgcaaacaagtgcgcggtttcaa
cggagaaagtcaccggcgctatggcggggagcgatcctgcgttaaacaaaagcgaacagg
ttatccggcgcgtacaggaaagcatggagaatcttgctaaatctacggaaaagtacaagg
atattgggaaatcatcagtattatcagtcaataacatttcaagtggatttgcagagacga
atgcaccggcagagcagattggaaagacactccaacgtatcaaaggaaccgtagaacaag
ccgggagatcaattgaaaagtatggaactgtagaaaaagcagttgtaaacaaagtagcag
gcgcttttgaacaagcggcagcagcagcggataagtatactactgcaacagaaaaagtag
caggcgctgtaactggagcaactgccccattaaataacagcgaacaggttatccggcgcg
tacaggaaagcatggagaatcttgctaaatctacagagaagtacaaaaatattgggaaat
taccgattaatgatttttcaggcggattggcagaagccaatgcgcccgcggatcaagttg
ataagacaatccaacgtgtcagggacggtactgaacaggccagaaaatccacggagaaat
acgggaaagcggcaaaatctgccgcgagtaaagcagcgggagcatttgaaaagctgggca
aggtgataaaaaatgccctgattattggagtgttttacaagtctttccgcagtttgttta
aattcatttcagacggaattaaagcagctatttccgcgcctgaaattgaaaatatgttca
acgtggcgtttggaagtatggcatatcaggcggatcaatttgcgctgcgtctcaaaaagg
cgtttggcgtagatcagattgcggttaagcagatgcttggcactttccaaaatttcaatg
attcaatgggaattggagcgcagacagcttataagatgtcaacgactctgacccaattgg
cctacgatatggcgtcgctctatgaaatggacgtcaatcaggtgtatgaaaacctgcaat
ccgggctgcaaggaatgccgcgcgcattgtacaaatatggtatcgccatcacagacgcaa
atatcaggcaaaccgcgctgcggtatggaatcggagagactgggcgggaactgacgtcac
aggaaaaaattatcgcccgatacataactattttagaacagaccaagaacgcgcagggag
acatggcacgcaccatcgagtcaccggcgaaccaactgcgcattttaaaaagccagttga
cagcggccggccgtgcgattggacaagcgttcatgccgttcattcaagctgttctgccgt
ttttgaacgcattggcggttgtgcttgaacgcgtggggaatgccctggcgcgttttacat
tccgtttgtttgggcgcgattttgacgccgaaatgaaggagaagcaagaagctctgaaaa
atttgggcgacagtacgggaagtgtggcaggagcgcaggaggaccttgcagacggcatca
atgatgcgaaaaagtctgcgaaaggcgcgttggcgccctttgatgaactgaccgtgctgc
aaaaagatatggctgatgcatctgtgccggacatgtcaggcggggcatatgagtttccag
atctgcctacgcttgagccgccggagggtgaatccccatatgaaaagatggccgatagaa
tactggcaaagtttacagaaatatttaatgagatcagaacgttttgggacaaatactttg
cagagccttttgcacaggcgtgggctaaaataagcccgcaaattgaaaagcttaaagaca
ctttcgggaaaatatttgccgacattttaacactcgcgcagccattgacagattggtttt
ataataatgcaattccaatgttgcagcagttagtaataacaggcggtgatgtgctggcag
gtcttttggatagcattaatatggttattctagacatctggaatgcccttttcccaatga
tacaggcatttatagaattggcgctgccggccattacagattttgtaacagaatcgataa
aaacctttggaactctattcgatgaagtcaaaaaaatatttgatttaatttggacgggag
ctataaaacctgcattggacttgatctcacaaatttggcaggaccttatgcaggacatta
aagatttatgggataagtggggcgtaaccacttttgagaatattcgtgaaacaattcgaa
ccatatccggattgtttcaaaaaacttgggaaacggttttaaagcctatctttgataaaa
tatttcaagtgcttggggaattatggaccgagcatttgaatccattgctggtcaaaattg
gagattttgtaatgacactcgcaaatgcggcgatggatatctataaccagttcattgcac
ccattgtaggatggtttattgaaaccctagggcctgcgatttcagaaacggtcaatgtga
taatagatgtagtcgggggacttttaggagcgatttcagatgttgttgggagcattttag
atgtattgggtggggccattgattttatagcgggagtattaacaggcgattgggatcgtg
catgggatggcttggaaaggacatttacaggtgcgtgggatggaatggttaaattttttt
ctggtgtatgggaaacactcactgggttatttgatactctgatggaatcagcaaaaaatg
cagcggatcgtgttcttgaatttataggacttaaagaaaagacgaaagaggcagcagatg
aagttggagaagcaatcacaactggaacagaggaggggatcaagaagaattccaacaagc
cgcaaagtgcggcggttgatatgatggaccaatcgataaaaggtgccaaagaaaaggctg
gaattcattcaccatcgacagtattcgcagagattggtgaaaatttaattttgggattgg
cagaaggtatccgaaacggtacatctacagcactttcatctatccaagagcttgtaaatg
gcctgcgggacgcgctccaaacggcattctctacaatggattctatgggcggcgaaggtg
ttgaggttggtattatgcctggacagggcggcatgttctatcagtttggaatgcagctca
tgcaaggattgtcagcgggaataacggctggacaggtgcttgtaacacaggcaattgttg
cggccgctgatacaatcaaaactgattttaagacacaatttgagattgaagaattgtcag
gagtgttcacagagtacggacggacgtttgatgaaagccttgcaacaggtattaccgata
acacagaatttgtcttggaagctttacagggccttgccgaaactattgatgaacactatg
cggaattcatggaagaattcagcggtactttcgcggaagatatggacgaattgtatgaaa
ccttatcggatacggtttcgagcatggaggaatctgtaactgatgcgacatcacaaatga
ttaattcaatctcccgcctgatttcacgcattgaaaaagcgatagaccgtctgttagaac
tatatgatcttggcggatcatttggcggcggatcaggtcgggataaagataagtcaaaaa
cttctggctccggagagcgttcgatatcaggtcgcaccttagatattccccagttggcaa
aaggagcagttttgcggcgcccaacaattgtcaatgtagcagaatatgcaggagctatga
gcaatcccgaaatcgtttcaccgcgtaatattatgtatgatacggttgtagaagctaatg
ctccattagtatcagccatgtcgcagatagcgaatcgaattattactgccatagaagaaa
atcaaccaataacagaaataggggatgatatcatttatgcaagcgccaagcgcggcgcgc
gaaaatataaccgcatgatcggttcaattatataagaacaggaacgccccgttatttacg
gggcgttcctgttctatcgcagtttatctcttatatcatataatgtatctaatatttcgc
tgatggcttttaataatgatgcagataacatagtagaaagtgccattaaaataaatgcaa
taattagagtgagaagttgattgaatggtaatgaggccctatctaaagtggaaagcagaa
aagcaagaaataatatgatgcctccaatagttccagccaaaataatcagtttcacaagaa
catccaggacttcaacaacatttgaacggttataggttttaactaatcgaacctcttttg
attcttgcactggattcgtactattttgggttgataagatgtttaaggcacaatcagagc
acaatccaagcttttcaaattcggccgggatttccttgccgcaatttttgcatgtcatgg
tttacttccccccattgggttttttacggataataggggttgggtttaaacaaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EDS11234.1 Anaerotruncus colihominis DSM 17241     hypothetical protein ANACOL_01854
gi|167667104 Anaerotruncus colihominis DSM 17241 NCBI   hypothetical protein ANACOL_01854
gi|167770509 Anaerotruncus colihominis DSM 17241 NCBI   hypothetical protein ANACOL_01854
img|642205252 Anaerotruncus colihominis DSM 17241 IMG   hypothetical protein
ref|ZP_02442562.1 Anaerotruncus colihominis DSM 17241 RefSeq   hypothetical protein ANACOL_01854
tr|B0PAQ4 Anaerotruncus colihominis DSM 17241 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search