The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445337.5.peg.2277: Clostridium botulinum C str. Eklund

This feature in The SEED Viewer

NCBI Taxonomy Id: 445337

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_ABDQ01000016 from base 10139 to 20704 (10566 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2274 10139 10357 219 +           hypothetical protein locus|CBC_A1774, protein_id|ZP_02622269.2, gi|169338082
2275 13032 13238 207 + 2674         hypothetical protein locus|CBC_A1775, protein_id|ZP_02622272.1, gi|168187637
2276 13814 14026 213 + 575         hypothetical protein locus|CBC_A1776, protein_id|ZP_02622274.1, gi|168187639
2277 15352 16089 738 + 1325         Phage antirepressor protein locus|CBC_A1778, protein_id|ZP_02622276.1, gi|168187641
2278 17095 18312 1218 + 1005         hypothetical protein locus|CBC_A1779, protein_id|ZP_02622277.1, gi|168187642
2279 18330 18443 114 + 17         hypothetical protein locus|CBC_A1780, protein_id|ZP_02863198.1, gi|169338080
2280 18633 19757 1125 + 189         transposase locus|CBC_A1781, protein_id|ZP_02622278.1, gi|168187643
2281 19895 20704 810 + 137         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|445337.5.peg.2277 Phage antirepressor protein
MSKEIKRVGITEILGKEIEFYSSWEEPYFVANEVAIWLGERDGSTVARKVDDDEKLIHTI
CVTGQNRETTMLTEDGLYEALMKSRKEIAKPLKKKIKQYLKQIRKTGGAVEDGREEEFIY
KYFPSFSDDVKMSMVQDLLKSNKELKPKADYHDKVLNPTDENFKKLLTTSDIAKDLNMSA
RKLNSLLHEFHIIYKQGKTWMPYAEYQDMIPEYFDYHVSEYGQVLKYTEKGRKWIIELLK
EKEII

MD5 = 730935fb572622d3d8cdb25ecdc098bf


  DNA Sequence

>fig|445337.5.peg.2277 Phage antirepressor protein
atgtcaaaagaaattaaaagagtaggtataacagaaatattaggaaaggaaatagagttt
tatagtagttgggaagaaccttattttgtagcaaatgaagttgctatatggctaggtgaa
agagatggatcaacagttgcacgaaaggtggatgatgatgaaaagctgatacacacaatc
tgtgtaacaggtcaaaatcgtgaaactacaatgttaacagaggatgggttgtacgaagcg
ttgatgaaatcaagaaaagaaattgcaaaaccattaaaaaagaaaataaaacaatattta
aaacaaattagaaaaacaggtggagcagtagaagatggtagagaggaagaatttatttat
aaatatttcccaagttttagtgatgatgtaaagatgtctatggttcaagatttattaaaa
tctaataaagaattaaaacctaaagcagattatcatgataaagttttaaatcctacagat
gaaaattttaaaaaattattaactacaagtgatattgcaaaagatttaaatatgtcagct
agaaagttaaattcactattgcatgaattccatattatatataaacaaggtaaaacatgg
atgccttatgcagaatatcaagacatgatacctgaatatttcgattatcatgttagcgag
tatggacaagtattaaaatatacagaaaaaggtagaaagtggattatagaattattaaaa
gaaaaagaaattatttaa


  DNA with Flanking Sequence

>fig|445337.5.peg.2277 Phage antirepressor protein
gatattatctactaccaatagataataagggaattaacaaaagaagtaagaaggtggcga
ggagatataaaattaggaaaagaatagttactactcaaaaaactaaaaatgtattatata
aatttttaggcttacctgtaggattatcattgttcacattattaatatacggattttttc
atataggagagacaaactgctatacaaactgtagtagcttaggcaaggcagggtacgttg
aaacagtaacaatctcgatatgggtatgtttgtccatattttgagtagcagcagactgcg
ttaattactgaagatagtaacaaagaacttaatggagacatatggataaattatgattat
atttgcagtaaaaattacatatttaaaaagttaattaagcaattattaaaagaggatgga
tggataattaaataaaacatcaataaaaattaattttacaatacaattaaaaataaaata
aattatagggaggaatatttatgtcaaaagaaattaaaagagtaggtataacagaaatat
taggaaaggaaatagagttttatagtagttgggaagaaccttattttgtagcaaatgaag
ttgctatatggctaggtgaaagagatggatcaacagttgcacgaaaggtggatgatgatg
aaaagctgatacacacaatctgtgtaacaggtcaaaatcgtgaaactacaatgttaacag
aggatgggttgtacgaagcgttgatgaaatcaagaaaagaaattgcaaaaccattaaaaa
agaaaataaaacaatatttaaaacaaattagaaaaacaggtggagcagtagaagatggta
gagaggaagaatttatttataaatatttcccaagttttagtgatgatgtaaagatgtcta
tggttcaagatttattaaaatctaataaagaattaaaacctaaagcagattatcatgata
aagttttaaatcctacagatgaaaattttaaaaaattattaactacaagtgatattgcaa
aagatttaaatatgtcagctagaaagttaaattcactattgcatgaattccatattatat
ataaacaaggtaaaacatggatgccttatgcagaatatcaagacatgatacctgaatatt
tcgattatcatgttagcgagtatggacaagtattaaaatatacagaaaaaggtagaaagt
ggattatagaattattaaaagaaaaagaaattatttaataatacatattatacaattaaa
ttaaaaataaattatacatatcatactaacagatatttgtgagtataatataactttgta
aaggaaaaataatattgatgtagaatttaaaaagtgtatatcaatattattttcccctcc
tttaggttatagaaattataaatgtattatcaattccagtagtaaaatactgattgccct
gtctataatcttccagagttaaaaaagaagatgtttaattttcacgtgcctagtaaatta
attaaaactgttattttatattgactatagagttaaaaaacccttaatatacaagggttt
tattttgatataaaaataaattaaatttgacaagataattgtattgacaaatctatccaa
taaagttatacttatattaaattaaaaaataattaaaataaatgataggtttaatatact
tttaactctgcaaataatagtggctaaaaatataatctaattgttaaataatgctatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EDS76612.1 Clostridium botulinum C str. Eklund     anti-repressor
gi|168187641 Clostridium botulinum C str. Eklund NCBI   anti-repressor
gi|169294479 Clostridium botulinum C str. Eklund NCBI   anti-repressor
img|642091197 Clostridium botulinum C Eklund IMG   anti-repressor
ref|ZP_02622276.1 Clostridium botulinum C str. Eklund RefSeq   anti-repressor
tr|B1BD47 Clostridium botulinum C str. Eklund TrEMBL   Anti-repressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search