The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445337.5.peg.2276: Clostridium botulinum C str. Eklund

This feature in The SEED Viewer

NCBI Taxonomy Id: 445337

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_ABDQ01000016 from base 9606 to 19757 (10152 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2272 9606 9794 189 +           hypothetical protein locus|CBC_A1772, protein_id|ZP_02622267.1, gi|168187632
2273 9815 10126 312 + 20         hypothetical protein locus|CBC_A1773, protein_id|ZP_02622268.1, gi|168187633
2274 10139 10357 219 + 12         hypothetical protein locus|CBC_A1774, protein_id|ZP_02622269.2, gi|169338082
2275 13032 13238 207 + 2674         hypothetical protein locus|CBC_A1775, protein_id|ZP_02622272.1, gi|168187637
2276 13814 14026 213 + 575         hypothetical protein locus|CBC_A1776, protein_id|ZP_02622274.1, gi|168187639
2277 15352 16089 738 + 1325         Phage antirepressor protein locus|CBC_A1778, protein_id|ZP_02622276.1, gi|168187641
2278 17095 18312 1218 + 1005         hypothetical protein locus|CBC_A1779, protein_id|ZP_02622277.1, gi|168187642
2279 18330 18443 114 + 17         hypothetical protein locus|CBC_A1780, protein_id|ZP_02863198.1, gi|169338080
2280 18633 19757 1125 + 189         transposase locus|CBC_A1781, protein_id|ZP_02622278.1, gi|168187643

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|445337.5.peg.2276 hypothetical protein
MDREELIKLIQDNTMESKEVVECLGISKQRLSDMNRTGKLIAVKKGIYLKQDVLARKEEQ
EELRNKYYKR

MD5 = 8a3b922515b4068c7b0646ca4669f6e0


  DNA Sequence

>fig|445337.5.peg.2276 hypothetical protein
atggatagagaagaacttataaaactaatacaagacaatacaatggaatctaaagaagta
gtagagtgcttaggtatatctaaacaacgtttatccgatatgaatagaacgggtaagctt
atagcagtaaaaaaaggtatatatcttaagcaggatgttttagctagaaaagaagaacaa
gaagaactaagaaacaaatattataaaagataa


  DNA with Flanking Sequence

>fig|445337.5.peg.2276 hypothetical protein
tgtacttactcttatatctcttatactaactatcattaatttttgtcttatgcactataa
atgatagtatacttatcgttatagcttatatatattatttgtcagtataataaaagagaa
catcaaacaaataaactttgacattataaaaataactaaattaataccagcttttgcaat
agcaacaacaaaagatatttttaaaactataatagaatataatatatattaaaattttga
aaccttgtttaatacaaggtttattttttttgcaaaattatataattttcccataatacc
tatttacctattacgtacagatgatataatataaatatagtgagtaaggaaaaagggtgg
atggattaaatgaaaactaatgtatataaagagtgtaccgtcttaattttaaaaatttta
gttaaactttgtgttataggattcttattatttttaatattcaaatcagtttttatttaa
aaaaataggaggtacttaaaatggatagagaagaacttataaaactaatacaagacaata
caatggaatctaaagaagtagtagagtgcttaggtatatctaaacaacgtttatccgata
tgaatagaacgggtaagcttatagcagtaaaaaaaggtatatatcttaagcaggatgttt
tagctagaaaagaagaacaagaagaactaagaaacaaatattataaaagataaagatgta
aaacaacatgacgtatttatttggaacactagtatcaataattctgttactgttcatttt
taaaactaaaaaagatataaaggtcttagaaatggaagtcaacgagctaaaggaaaaagc
aagccaaaaataatatcttcaattttttcaccagaactattaaagtagttttaaattttt
cgtatgcagtatatgtaatataattaactaaattcatatactacataaggaaaatggcaa
ggtaactgccaagcttcagcttgtgcagagtattcagatataatacaccttctaaaataa
attaaaactttttaaattcgaaaattgtttaagtgaacccttgaattaaaatattagttt
tatataaactaagtccccatataaagaatataaattctttatatggggattagtaggagt
ttagacctttgtcagggaaaatttattcatagaaccttttgaggtactcgttaggaatac
tgaaacacttagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EDS76615.1 Clostridium botulinum C str. Eklund     conserved hypothetical protein
gi|168187639 Clostridium botulinum C str. Eklund NCBI   conserved hypothetical protein
gi|169294482 Clostridium botulinum C str. Eklund NCBI   conserved hypothetical protein
img|642091195 Clostridium botulinum C Eklund IMG   conserved hypothetical protein
ref|ZP_02622274.1 Clostridium botulinum C str. Eklund RefSeq   conserved hypothetical protein
tr|B1BD45 Clostridium botulinum C str. Eklund TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search