The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|445334.5.peg.2746: Clostridium perfringens C str. JGS1495

This feature in The SEED Viewer

NCBI Taxonomy Id: 445334

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_ABDU01000074 from base 9842 to 22240 (12399 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2738 9842 11749 1908 +       2: 3 2   Selenocysteine-specific translation elongation factor gene_name|selB, locus|CPC_2419, protein_id|ZP_02865722.1, gi|169346771
2739 11936 12385 450 + 186         FIG00513154: hypothetical protein locus|CPC_2418, protein_id|ZP_02865719.1, gi|169346768
2740 12413 13768 1356 + 27     1: 1   RNA methyltransferase, TrmA family gene_name|rumA, locus|CPC_2417, protein_id|ZP_02865754.1, gi|169346803
2741 14972 13833 1140 - 64 5     site-specific recombinase, phage integrase family locus|CPC_2416, protein_id|ZP_02865770.1, gi|169346819
2742 15431 15009 423 - 36         hypothetical protein locus|CPC_2415, protein_id|ZP_02865741.1, gi|169346790
2743 15909 15463 447 - 31         Helix-turn-helix motif locus|CPC_2414, protein_id|ZP_02865737.1, gi|169346786
2744 16150 16389 240 + 240         hypothetical protein locus|CPC_2413, protein_id|ZP_02865748.1, gi|169346797
2745 16373 16627 255 + -17         hypothetical protein locus|CPC_2412, protein_id|ZP_02865725.1, gi|169346774
2746 16624 17394 771 + -4       Phage antirepressor protein locus|CPC_2411, protein_id|ZP_02865761.1, gi|169346810
2747 17406 17603 198 + 11         hypothetical protein locus|CPC_2410, protein_id|ZP_02865764.1, gi|169346813
2748 17615 17794 180 + 11         conserved domain protein locus|CPC_2409, protein_id|ZP_02865752.1, gi|169346801
2749 17811 18038 228 + 16         hypothetical protein locus|CPC_2408, protein_id|ZP_02865745.1, gi|169346794
2750 18056 18238 183 + 17         hypothetical protein locus|CPC_2407, protein_id|ZP_02865738.1, gi|169346787
2751 18339 18578 240 + 100         FIG00534329: hypothetical protein locus|CPC_2406, protein_id|ZP_02865757.1, gi|169346806
2752 18582 18770 189 + 3         hypothetical protein locus|CPC_2405, protein_id|ZP_02865724.1, gi|169346773
2753 18789 19442 654 + 18         putative Gp40-related protein, ERF family single-strand annealing protein (phage) locus|CPC_2404, protein_id|ZP_02865735.1, gi|169346784
2754 19455 20366 912 + 12         FIG00528287: hypothetical protein locus|CPC_2403, protein_id|ZP_02865747.1, gi|169346796
2755 20381 20569 189 + 14         FIG00532023: hypothetical protein locus|CPC_2402, protein_id|ZP_02865768.1, gi|169346817
2756 20582 21298 717 + 12         FIG00529397: hypothetical protein locus|CPC_2401, protein_id|ZP_02865736.1, gi|169346785
2757 21320 21472 153 + 21         conserved hypothetical protein locus|CPC_2400, protein_id|ZP_02865717.1, gi|169346766
2758 21466 21648 183 + -7         putative lipoprotein locus|CPC_2399, protein_id|ZP_02865731.1, gi|169346780
2759 21652 22047 396 + 3         endodeoxyribonuclease RusA family protein locus|CPC_2398, protein_id|ZP_02865720.1, gi|169346769
2760 22052 22240 189 + 4         hypothetical protein locus|CPC_2397, protein_id|ZP_02865718.1, gi|169346767

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|445334.5.peg.2746 Phage antirepressor protein
MNNQLQIFNNQEFGQIRTLFIENEGWLVGKDITDILGYSNSSDALKNHVDEDDKKKIAFS
DYPQFGNKGAVLINESGLYSLILRSNLPKAKKFKRWVTSEVLPSIRNYGAYMTENTLEKA
LTSPDFLIQLATNLKEEQEKRRLLEEEKERNAPKVIFADAVSTSHTSILVGELAKLMKQN
GIDTGEKRLFKWLRDNGYLIKRKGTDYNMPTQKSLELKIIEIKERTINNPDGSIRITKTP
KITGKGQQYFINKFLN

MD5 = 0369474f9c0ffdd184f634eebb38d1bd


  DNA Sequence

>fig|445334.5.peg.2746 Phage antirepressor protein
atgaataatcaattacagatttttaataatcaagaatttggacaaattagaacattattt
atagaaaatgaagggtggttagttggtaaggatataacagatattctaggatattcaaac
tcaagtgatgctttaaaaaatcatgtggacgaagatgataagaagaaaatcgcgttttcc
gattatcctcaatttggaaataaaggagcagtattaataaatgaaagtggtttatatagt
ttaatacttagaagtaatttaccaaaagcaaagaaatttaaaagatgggttacatcagaa
gtactaccttcaataagaaattatggagcatatatgactgaaaatactttagaaaaagca
ttaacaagtccagatttcttaattcaattagcaacaaacttaaaagaggaacaagaaaag
agaagattacttgaagaagaaaaagaacgtaatgctccaaaagttatttttgctgatgca
gttagtacaagccatacatcaatacttgttggagagctagctaagttaatgaaacaaaat
ggaatagatactggagaaaagaggttgtttaagtggcttagagataatgggtaccttata
aaacgtaaagggacagattataatatgccaactcaaaagagcttagaacttaagataata
gaaattaaggaaagaacaataaataatccagatggtagtatcagaattactaagacaccc
aagatcactgggaaaggtcaacaatatttcataaataaatttttaaattag


  DNA with Flanking Sequence

>fig|445334.5.peg.2746 Phage antirepressor protein
aaacgtaaaatggagaggtgaaagaaatgaatgaacttatagcaggattaccttggtata
aaaaaattgaaattttaagaattatcaaggggtggactcaagaagaagcagctgaaaaat
gttttactaaacagaaggcttattggacttgggaaaaaggaaatgcttatccaagaaaaa
atagtagaagggctatttcacaagcttttgaagtggatgaaaatgagatatttaaggagg
aaaaagaaaatgttaagggaaattaattttgaaataactaatcaagatttttttatagag
attataagtaatgaagtaaaaaaatactcaataatgaacccttttgatgtttttaaattg
aatgaagttttacgttctttaaatactagttttgagataaaatttgaaaattttattcaa
tattataagcttataaaaaaaatagcaacttattttaaaatacctatgaaacctaaaaaa
atactttgggaggagaagcaatgaataatcaattacagatttttaataatcaagaatttg
gacaaattagaacattatttatagaaaatgaagggtggttagttggtaaggatataacag
atattctaggatattcaaactcaagtgatgctttaaaaaatcatgtggacgaagatgata
agaagaaaatcgcgttttccgattatcctcaatttggaaataaaggagcagtattaataa
atgaaagtggtttatatagtttaatacttagaagtaatttaccaaaagcaaagaaattta
aaagatgggttacatcagaagtactaccttcaataagaaattatggagcatatatgactg
aaaatactttagaaaaagcattaacaagtccagatttcttaattcaattagcaacaaact
taaaagaggaacaagaaaagagaagattacttgaagaagaaaaagaacgtaatgctccaa
aagttatttttgctgatgcagttagtacaagccatacatcaatacttgttggagagctag
ctaagttaatgaaacaaaatggaatagatactggagaaaagaggttgtttaagtggctta
gagataatgggtaccttataaaacgtaaagggacagattataatatgccaactcaaaaga
gcttagaacttaagataatagaaattaaggaaagaacaataaataatccagatggtagta
tcagaattactaagacacccaagatcactgggaaaggtcaacaatatttcataaataaat
ttttaaattaggagaaagagatatgaaagtttattcagttgaagaaacaactaaaatatt
aaaaactagctttgatgttgtatacaaactgattgaaaagaaaatgttagtagcgttaaa
gcttaaatcacttaaagtgccagaatatgcgatagaagaattttttagaaagtatgaatt
tatggatttaagcgacttaaacaatataaaaaagatgtaggaggttattatatgttaact
ccaaacggaagaataattttagggataatatcaatagttacagctctatatttaagtctt
tactttatgattaaaagcctagatgaaaaagagcctagaaaaagctttaaatatttaata
ctaagcacatgtaatatgttagctttaatattttcagcaaatgtaatttaaaaggagtgt
tttgattatgaatttaaacataatagaaaatttcttgaatcaagcagtagagtttctaat
agagttaggaccaagtattttagagaaggct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EDS79214.1 Clostridium perfringens C str. JGS1495     phage antirepressor protein
gi|169297092 Clostridium perfringens C str. JGS1495 NCBI   phage antirepressor protein
gi|169346810 Clostridium perfringens C str. JGS1495 NCBI   phage antirepressor protein
img|642098380 Clostridium perfringens C JGS1495 IMG   phage antirepressor protein
pathema|bcpe2.164.cds.ORF02382 Clostridium perfringens     77ORF010
ref|ZP_02865761.1 Clostridium perfringens C str. JGS1495 RefSeq   phage antirepressor protein
tr|B1BLW5 Clostridium perfringens C str. JGS1495 TrEMBL   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|445334.5.peg.2741 site-specific recombinase, phage integrase family


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search