The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|440497.10.peg.901: Lactobacillus jensenii 1153

This feature in The SEED Viewer

NCBI Taxonomy Id: 440497

Current Assignment: Single-stranded DNA-binding protein
Translate Function Assignments



Context on contig NZ_DS995846 from base 35 to 10993 (10959 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
893 35 703 669 +   4     Phage antirepressor protein  
894 1040 1210 171 + 336         hypothetical protein  
895 1393 1917 525 + 182         hypothetical protein  
896 1919 2248 330 + 1         hypothetical protein  
897 2381 2608 228 + 132         hypothetical protein  
898 2923 3672 750 + 314 4     Replication protein O  
899 3669 4100 432 + -4         FIG00742629: hypothetical protein  
900 4084 4890 807 + -17     1: 4   Helicase loader DnaI  
901 4869 5360 492 + -22   3: 1 3 2   Single-stranded DNA-binding protein  
902 5370 5975 606 + 9         FIG00746672: hypothetical protein  
903 6091 6384 294 + 115         Phage Holliday junction resolvase  
904 6381 6905 525 + -4         hypothetical protein  
905 6908 7216 309 + 2         FIG00745481: hypothetical protein  
906 7226 8011 786 + 9         FIG00750926: hypothetical protein  
907 7992 8237 246 + -20         hypothetical protein  
908 8221 8469 249 + -17         FIG00747828: hypothetical protein  
909 8435 8908 474 + -35         Phage related protein  
910 8901 9218 318 + -8         hypothetical protein  
911 9866 10993 1128 + 647         FIG00745254: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA_repair,_bacterial gjo Single-stranded DNA-binding protein
DNA_repair,_bacterial_UmuCD_system gjo *Single-stranded DNA-binding protein
DNA_repair,_bacterial_RecFOR_pathway gjo Single-stranded DNA-binding protein


  Protein Sequence

>fig|440497.10.peg.901 Single-stranded DNA-binding protein
MAEFDEIKEGYQVINRVVLVGRLTKDINLRKTQSGISVGLFTLAVNRQYSKDKEHKEADF
VSCIVWRKGAEILSQYTHKGSRIGIDGRIQTRNYEDKNGQRVYVTEVVVDNFELLDSKPE
QATTSTSVAQTQTTTQAQPAQQTPDPFADGGDTIDISDDDLPF

MD5 = 50a6040fafcb4f27f06d3e6ff749c2b6


  DNA Sequence

>fig|440497.10.peg.901 Single-stranded DNA-binding protein
atggcagaatttgatgaaataaaagaaggttaccaagtgattaatagagtagttttagtt
ggtcgattgaccaaagatattaatttgagaaaaacacagagtggaatttccgttggactc
tttactttggcagtaaacagacagtacagcaaagacaaagaacacaaagaggcggacttt
gtcagctgcattgtttggcgaaaaggtgctgaaatcctatcacagtacactcacaaaggt
tcaagaattgggattgacggtcgtattcaaaccagaaattacgaagataagaatggccaa
agagtttatgtgactgaagttgttgtagataactttgaacttctcgacagtaagccagaa
caagcaactacaagcacatctgttgctcagactcagaccacaacgcaagcacaacccgct
caacaaactccagatccatttgctgatggaggagacacgattgacattagtgacgatgat
ttgccgttctag


  DNA with Flanking Sequence

>fig|440497.10.peg.901 Single-stranded DNA-binding protein
caattatgtcataaaattgcaggtcagtattaccaatatccagaagcaaagttcaacacg
ctattagttggaactgcaggaactggaaagtcacatcttgcaatgtcaatgctgaaagca
gtaaatgaccattctaaagctcaaaagtgcttatttattaatattgctgaattgttccaa
aagattagaaactctttcaatgatccaagcgagtattggacagaaggcagagcagtttta
aagattactgatgctgatttagttgtcttagatgatttaggaactgaagcgagtatgaga
gcttctggagatgaagccagccagtttgtacagcgtgtactctacagcatacttaactct
cagaaaagaattatcgtaacaagcaatttaactgttgaacagtttcagaaagtatacaat
cagaagctgttctcacgacttacacgaggtgcaaaaggacatgtggtagattttacacaa
ttaaaggataaacgctcagaatggcagaatttgatgaaataaaagaaggttaccaagtga
ttaatagagtagttttagttggtcgattgaccaaagatattaatttgagaaaaacacaga
gtggaatttccgttggactctttactttggcagtaaacagacagtacagcaaagacaaag
aacacaaagaggcggactttgtcagctgcattgtttggcgaaaaggtgctgaaatcctat
cacagtacactcacaaaggttcaagaattgggattgacggtcgtattcaaaccagaaatt
acgaagataagaatggccaaagagtttatgtgactgaagttgttgtagataactttgaac
ttctcgacagtaagccagaacaagcaactacaagcacatctgttgctcagactcagacca
caacgcaagcacaacccgctcaacaaactccagatccatttgctgatggaggagacacga
ttgacattagtgacgatgatttgccgttctaggaggaaagcatggaagcacaacaacttg
cagatattcaaaacctcgaaaagaaatatggctctttgtcgcaagtccctgaagacaatg
agaaattgttgaaacttagaaaaagcttcagtggtaattaccatgacacaccattaacta
aagcttttggaaggtcaattagtgagaattcactgcacagagtaaaggttgcagcaagaa
atattggtgaaaaaggtcgacaggagattattgatttactaaaagacggctacacttcaa
ctgagattagtacagtatttggttacaacactgctgcaatttcaggtgtgagaaatatct
atcacattgaagcaaggcctcacttcatgtatgagttgaaaaaagatggtaagccagttc
tctatactcaaacacttggacaggttcgtgattttactaaatataaaccaaaaagaatgt
actatattgcgtacaaatatattagagaagagctatctgagcaaggatatgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|596325.3.peg.657 Lactobacillus jensenii 269-3 FIG   Single-stranded DNA-binding protein
fig|596326.3.peg.2266 Lactobacillus jensenii 208-1 FIG   Single-stranded DNA-binding protein
gb|EEQ24697.1 Lactobacillus jensenii 269-3     single-stranded DNA binding protein
gb|EEQ68466.1 Lactobacillus jensenii 1153     single-stranded DNA-binding protein
gi|238832389 Lactobacillus jensenii 269-3 NCBI   single-stranded DNA binding protein
gi|238855018 Lactobacillus jensenii 269-3 NCBI   single-stranded DNA binding protein
gi|239529465 Lactobacillus jensenii 1153 NCBI   single-stranded DNA-binding protein
gi|239632666 Lactobacillus jensenii 1153 NCBI   single-stranded DNA-binding protein
ref|ZP_04645347.1 Lactobacillus jensenii 269-3 RefSeq   single-stranded DNA binding protein
ref|ZP_04675697.1 Lactobacillus jensenii 1153 RefSeq   single-stranded DNA-binding protein
tr|C4VM22 Lactobacillus jensenii 269-3 TrEMBL   Single-stranded DNA binding protein
tr|C5G3Y7 Lactobacillus jensenii 1153 TrEMBL   Single-stranded DNA-binding protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|440497.10.peg.893 Phage antirepressor protein
4 fig|440497.10.peg.898 Replication protein O


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search