The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|440497.10.peg.896: Lactobacillus jensenii 1153

This feature in The SEED Viewer

NCBI Taxonomy Id: 440497

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_DS995846 from base 35 to 8011 (7977 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
893 35 703 669 +           Phage antirepressor protein  
894 1040 1210 171 + 336         hypothetical protein  
895 1393 1917 525 + 182         hypothetical protein  
896 1919 2248 330 + 1         hypothetical protein  
897 2381 2608 228 + 132         hypothetical protein  
898 2923 3672 750 + 314         Replication protein O  
899 3669 4100 432 + -4         FIG00742629: hypothetical protein  
900 4084 4890 807 + -17     1: 4   Helicase loader DnaI  
901 4869 5360 492 + -22     3: 1 3 2   Single-stranded DNA-binding protein  
902 5370 5975 606 + 9         FIG00746672: hypothetical protein  
903 6091 6384 294 + 115         Phage Holliday junction resolvase  
904 6381 6905 525 + -4         hypothetical protein  
905 6908 7216 309 + 2         FIG00745481: hypothetical protein  
906 7226 8011 786 + 9         FIG00750926: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|440497.10.peg.896 hypothetical protein
MEDLINRKSLQDLIKSTFLEMRPKLEDELTGRTIKLDEFRKKYCGGKSAEWVRTFIFDKF
RNEIDYETGGWCINPRQNANGRYAIIFEDTAAKWMKENRHRINWYAKLR

MD5 = 83d3ec149680d330baf39600063448da


  DNA Sequence

>fig|440497.10.peg.896 hypothetical protein
atggaggacttaattaatcgaaaatctttgcaagatttaatcaaatcaacgttcttagag
atgagacccaagcttgaagatgagcttactggcaggactattaagctcgatgaatttcgc
aaaaagtattgcggtggaaagtctgctgagtgggttagaacgtttattttcgataaattt
cgcaatgaaattgactatgaaactggtggctggtgcattaatccacgtcaaaacgctaat
ggacgttacgcaatcatatttgaagacactgcagctaaatggatgaaagaaaaccgacac
agaattaattggtatgcaaagttgaggtaa


  DNA with Flanking Sequence

>fig|440497.10.peg.896 hypothetical protein
cgacatctgccaacttattaatggctctgatttaggagttaaagcactgcttttgaaaga
tgacaatcaaattgtcatagcacgtggttgctttggattagtatttgaccttaacaaaga
tttgacagaattatttccagaccatccagaacttgaagcggttgtgtttgaaggactgat
taagcagtatcgaagcatgattaatttaaagatgccagatgctgaatatttcaaaaagca
taataagcaagaattcagcaaagacgtattaatgatttcagattgcttctgcgatggctt
ctggttaggctacgacactagaagtgatgattatttactaacttgggaagattactcagt
aagagcacctttagacatcaagttctatctcgttaggcctgtaacttttaaagggaaagc
atacgaagagctcgataacttcattaaatcaacgtattaccgaggaattatagatttgaa
ttttgtattaggagattgacatggaggacttaattaatcgaaaatctttgcaagatttaa
tcaaatcaacgttcttagagatgagacccaagcttgaagatgagcttactggcaggacta
ttaagctcgatgaatttcgcaaaaagtattgcggtggaaagtctgctgagtgggttagaa
cgtttattttcgataaatttcgcaatgaaattgactatgaaactggtggctggtgcatta
atccacgtcaaaacgctaatggacgttacgcaatcatatttgaagacactgcagctaaat
ggatgaaagaaaaccgacacagaattaattggtatgcaaagttgaggtaacttatgacag
aaaataatgatcgtttaagacacaaattccatttcatttttaatggcgatggctttttct
ggagcactccagatgaaaaagccaagcttatatgtcgtactgcaaacagagattttaata
cagtggctgagattgttaagtggaatgattatgtagataaacattacaaagggaaaaaca
aagttaagtactatttttgtatagaaactgaatctgataaatctgtatttctttatgatt
ttacgggaaaaagacctaaggtttgcaaagacaaagaaatgactgaaaaagcttttgaag
gaaaattaccattatttaaattacgaggagaaaaggaagatgaactatgaaattattaca
agcatggagagagaagcaagcagttacttaccaagacttactaaacacgattttaaaacg
ctggaacaaacaaatcacagtagacggtgctttcaaggtctggtgtattacagcaatgct
cttggcggtc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|596325.3.peg.662 Lactobacillus jensenii 269-3 FIG   hypothetical protein
fig|596326.3.peg.2271 Lactobacillus jensenii 208-1 FIG   hypothetical protein
gb|EEQ24702.1 Lactobacillus jensenii 269-3     conserved hypothetical protein
gb|EEQ68460.1 Lactobacillus jensenii 1153     conserved hypothetical protein
gi|238832394 Lactobacillus jensenii 269-3 NCBI   conserved hypothetical protein
gi|238855023 Lactobacillus jensenii 269-3 NCBI   conserved hypothetical protein
gi|239529459 Lactobacillus jensenii 1153 NCBI   conserved hypothetical protein
gi|239632660 Lactobacillus jensenii 1153 NCBI   conserved hypothetical protein
ref|ZP_04645352.1 Lactobacillus jensenii 269-3 RefSeq   conserved hypothetical protein
ref|ZP_04675691.1 Lactobacillus jensenii 1153 RefSeq   conserved hypothetical protein
tr|C4VM27 Lactobacillus jensenii 269-3 TrEMBL   Putative uncharacterized protein
tr|C5G3Y1 Lactobacillus jensenii 1153 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search