The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|440497.10.peg.893: Lactobacillus jensenii 1153

This feature in The SEED Viewer

NCBI Taxonomy Id: 440497

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_DS995846 from base 35 to 5975 (5941 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
893 35 703 669 +         Phage antirepressor protein  
894 1040 1210 171 + 336         hypothetical protein  
895 1393 1917 525 + 182         hypothetical protein  
896 1919 2248 330 + 1         hypothetical protein  
897 2381 2608 228 + 132         hypothetical protein  
898 2923 3672 750 + 314 9     Replication protein O  
899 3669 4100 432 + -4         FIG00742629: hypothetical protein  
900 4084 4890 807 + -17 5 1: 4   Helicase loader DnaI  
901 4869 5360 492 + -22 4 3: 1 3 2   Single-stranded DNA-binding protein  
902 5370 5975 606 + 9         FIG00746672: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|440497.10.peg.893 Phage antirepressor protein
MSQNATGYQNIDLITESGVYSLIFGSKLPTAKKFKHWVTSEVLPAIREHGAYMTDEKAFD
VVNNKAGLADLLQQAADQLKQKDIQIAEMKPKALFADSVATSNSTILVGELAKILRGNGI
EIGQNRLFDWLRKNGYLISKKGSSYNLPTQKSMNLGLFKIKETTINHSNGSVSISKTAKV
TGKGQQYFINKFLNAEEHSGYVFTGDSETEVVLTTNNEPILH

MD5 = 04b817606795dca8df443a553ba119d7


  DNA Sequence

>fig|440497.10.peg.893 Phage antirepressor protein
ttgtcgcaaaacgctacgggctatcaaaatattgatttaattacggaatctggtgtttat
tcattaattttcggtagcaaattaccaactgccaagaagtttaagcactgggtaactagt
gaagttctacctgcaattagagaacatggcgcctatatgactgatgaaaaggcatttgat
gttgttaacaataaggcaggccttgcagatctattgcaacaagctgcagaccagctcaag
caaaaagatattcaaattgctgaaatgaagcctaaagcactgtttgctgacagcgtagca
acttcaaactcaacgattttagttggtgaattagctaagattttgcgaggaaatgggatt
gagattggtcagaacagattgttcgactggttgagaaagaatggctacttaatttccaaa
aagggtagtagttacaacctaccaactcagaaatctatgaacctcggtttgttcaaaatt
aaggaaacaaccattaatcactctaacggttcagtatcaatcagcaagaccgctaaagtt
actggcaaaggccagcagtactttattaataagttcttgaatgcagaagaacactcaggc
tacgtatttactggcgactctgaaacagaagtggtgctaactacaaataatgaacctatc
ttacattga


  DNA with Flanking Sequence

>fig|440497.10.peg.893 Phage antirepressor protein
agataaaaagtccgagattgtgaatagttcacaattgtcgcaaaacgctacgggctatca
aaatattgatttaattacggaatctggtgtttattcattaattttcggtagcaaattacc
aactgccaagaagtttaagcactgggtaactagtgaagttctacctgcaattagagaaca
tggcgcctatatgactgatgaaaaggcatttgatgttgttaacaataaggcaggccttgc
agatctattgcaacaagctgcagaccagctcaagcaaaaagatattcaaattgctgaaat
gaagcctaaagcactgtttgctgacagcgtagcaacttcaaactcaacgattttagttgg
tgaattagctaagattttgcgaggaaatgggattgagattggtcagaacagattgttcga
ctggttgagaaagaatggctacttaatttccaaaaagggtagtagttacaacctaccaac
tcagaaatctatgaacctcggtttgttcaaaattaaggaaacaaccattaatcactctaa
cggttcagtatcaatcagcaagaccgctaaagttactggcaaaggccagcagtactttat
taataagttcttgaatgcagaagaacactcaggctacgtatttactggcgactctgaaac
agaagtggtgctaactacaaataatgaacctatcttacattgatgaaaggaataacaatg
actaaaaaacacagcatttgtcaggttacttttaacggcaaaagtgggagatgttatgaa
ggctacataattagtcgaaagtttacagaaactgcgatgattttcgctcaaaatcataat
tttgtactagaattcatccctttgtggaaagcaattctattcaagagaccgaaaggtaaa
tgggtatatttaaaagatgtgtcacttgagtacctacgagaaacaccattcaaggtggaa
aaatacagctgtatagcagaaatggacacttatagaaaatacaaaacaaatgaagaagct
aatagagaggaaaaaataaatgattaagatagctgatattgaatttgaaaaagatgctct
taacgatggctttaaagaatttataaccgaacttttgaaattcttagaaggaaaaacggt
tctttcaagtttttacgacgatgataaagaacaacttgaaattcaatatctagaaaaaga
gga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|440497.10.peg.898 Replication protein O
5 fig|440497.10.peg.900 Helicase loader DnaI
4 fig|440497.10.peg.901 Single-stranded DNA-binding protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search