The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|431943.8.peg.1988: Clostridium kluyveri DSM 555

This feature in The SEED Viewer

NCBI Taxonomy Id: 431943

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_009706 from base 1982343 to 1995340 (12998 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1972 1983281 1982343 939 -           Phage replication initiation protein locus|CKL_1893, protein_id|YP_001395281.1, gi|153954516, geneID|5392518
1973 1984116 1983322 795 - 40         prophage Lp1 protein 19 locus|CKL_1894, protein_id|YP_001395282.1, gi|153954517, geneID|5392519
1974 1985009 1984116 894 - -1     1: 2   Phage recombination protein Bet locus|CKL_1895, protein_id|YP_001395283.1, gi|153954518, geneID|5391998
1975 1985188 1985012 177 - 2         hypothetical protein locus|CKL_1901, protein_id|YP_001395284.1, gi|153954519, geneID|5391999
1976 1985430 1985191 240 - 2         hypothetical protein locus|CKL_1902, protein_id|YP_001395285.1, gi|153954520, geneID|5392000
1977 1985857 1985621 237 - 190         hypothetical protein locus|CKL_1903, protein_id|YP_001395286.1, gi|153954521, geneID|5393209
1978 1986001 1985861 141 - 3         hypothetical protein  
1979 1986404 1986003 402 - 1         Phage protein locus|CKL_1904, protein_id|YP_001395287.1, gi|153954522, geneID|5393210
1980 1986566 1986417 150 - 12         hypothetical protein  
1981 1986702 1986580 123 - 13         hypothetical protein locus|CKL_1905, protein_id|YP_001395288.1, gi|153954523, geneID|5393211
1982 1986892 1986707 186 - 4         hypothetical protein  
1983 1987140 1986889 252 - -4         hypothetical protein locus|CKL_1906, protein_id|YP_001395289.1, gi|153954524, geneID|5390830
1984 1987590 1987168 423 - 27         hypothetical protein locus|CKL_1907, protein_id|YP_001395290.1, gi|153954525, geneID|5390831
1985 1987749 1987597 153 - 6         hypothetical protein  
1986 1987944 1987750 195 - 0         hypothetical protein locus|CKL_1908, protein_id|YP_001395291.1, gi|153954526, geneID|5390832
1987 1988277 1988077 201 - 132         hypothetical protein locus|CKL_1909, protein_id|YP_001395292.1, gi|153954527, geneID|5392758
1988 1989077 1988274 804 - -4         Phage antirepressor protein locus|CKL_1910, protein_id|YP_001395293.1, gi|153954528, geneID|5392759
1989 1989571 1989098 474 - 20         FIG00528088: hypothetical protein locus|CKL_1911, protein_id|YP_001395294.1, gi|153954529, geneID|5392760
1990 1989975 1989796 180 - 224         FIG00519336: hypothetical protein  
1991 1990267 1990052 216 - 76         Phage transcriptional regulator cro  
1992 1990466 1990768 303 + 198     1: 1   Phage repressor protein cI locus|CKL_1912, protein_id|YP_001395295.1, gi|153954530, geneID|5391986
1993 1991336 1991082 255 - 313         hypothetical protein  
1994 1991494 1992135 642 + 157         Transcriptional regulator locus|CKL_1914, protein_id|YP_001395297.1, gi|153954532, geneID|5391988
1995 1992496 1992224 273 - 88         FIG00520071: hypothetical protein  
1996 1992538 1993086 549 + 41         hypothetical protein locus|CKL_1915, protein_id|YP_001395298.1, gi|153954533, geneID|5392656
1997 1993353 1993532 180 + 266         FIG00526941: hypothetical protein locus|CKL_1917, protein_id|YP_001395300.1, gi|153954535, geneID|5392658
1998 1993691 1995340 1650 + 158         Site-specific recombinases, DNA invertase Pin homolog locus|CKL_1918, protein_id|YP_001395301.1, gi|153954536, geneID|5392272

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|431943.8.peg.1988 Phage antirepressor protein
MSKLQIFRSKEFGQVRTTFINGKIHFVAVDIARALGYKNTNDAILKHCRWVAKCEVPHPQ
SKTKVIEVNAIPEGDIYRLVANSELPGAQEFESWIFDKVLPQINHTGGYIPNNEDESEED
ILAKAVLIAKRTIERKNEIIADKNKQLQEQKPKVIFAESVQASTTTILIGQLAKILKQNG
IDMGQNRLFEWLRKNGYLISRKGTDYNMPTQKSANLGLFTTKETTIGHSDGHVSISTTPK
VTGKGQVYFVNKFKELQEGVRERQATK

MD5 = d6aa0c8c18297a74d8a9f01966de1e99


  DNA Sequence

>fig|431943.8.peg.1988 Phage antirepressor protein
ttgagtaagttacaaatttttaggagcaaagaatttgggcaggtaagaactacatttata
aatggaaaaattcattttgtagctgtagatattgccagagcattaggatataaaaataca
aatgatgctattttaaagcactgtaggtgggtagcaaaatgcgaggtacctcatccacag
agtaaaaccaaagttatagaagtcaacgcaataccagagggtgatatttatagattggta
gcaaattctgaattacctggagcacaagaatttgaaagctggatatttgataaagtacta
ccacagataaatcatacaggtggttatataccaaataacgaggatgaatcagaggaagat
atattggctaaagctgttttgatagctaaaagaactattgaaagaaagaacgaaattata
gcagataagaataaacaacttcaggagcaaaagccaaaagtaatatttgcagaaagtgta
caggcatccactacaacaatcttgattgggcaacttgccaaaatattaaagcaaaatgga
attgacatgggacagaatagattatttgaatggcttcgtaaaaatggatacctgattagc
aggaagggtactgattataatatgcctacacaaaagtctgcgaatttaggattatttaca
acaaaggagacaactataggtcattcggatggtcatgtaagtatatctaccacaccaaaa
gtaactgggaaaggacaggtatattttgtgaataagtttaaggaattacaggaaggtgtt
agagaaaggcaggcgacaaaatga


  DNA with Flanking Sequence

>fig|431943.8.peg.1988 Phage antirepressor protein
agatatatgaaactggaaagcactaacaatgtatacatgaaagcaaggctaagggcagca
gagtataatgacaggcttaaaagtagagagggtgcaggaaaaatgtttggagtaagcgat
cgttcaatggcaaattatgaaaatgatttgtgtaaacagataccagtagatatggttgta
agaatggcagatacctataatgctccagagcttatgtaccattactgcaataatgagtgt
cctataggaaagtgtattgctcctaatgtagaacttaaagaaatatcatgtcttgcaatt
caactatcggttttatcgaagaatccagagacttttgtagaaagactaatggaaattttg
caggatggatctgttgataaagatgaaaaacaggattttatgactatagttaaaggtttg
atagagttttctgaaaagatacagtccttagaactttgggcaaagaagaatttgaagtga
gtagaaaggagggataaagattgagtaagttacaaatttttaggagcaaagaatttgggc
aggtaagaactacatttataaatggaaaaattcattttgtagctgtagatattgccagag
cattaggatataaaaatacaaatgatgctattttaaagcactgtaggtgggtagcaaaat
gcgaggtacctcatccacagagtaaaaccaaagttatagaagtcaacgcaataccagagg
gtgatatttatagattggtagcaaattctgaattacctggagcacaagaatttgaaagct
ggatatttgataaagtactaccacagataaatcatacaggtggttatataccaaataacg
aggatgaatcagaggaagatatattggctaaagctgttttgatagctaaaagaactattg
aaagaaagaacgaaattatagcagataagaataaacaacttcaggagcaaaagccaaaag
taatatttgcagaaagtgtacaggcatccactacaacaatcttgattgggcaacttgcca
aaatattaaagcaaaatggaattgacatgggacagaatagattatttgaatggcttcgta
aaaatggatacctgattagcaggaagggtactgattataatatgcctacacaaaagtctg
cgaatttaggattatttacaacaaaggagacaactataggtcattcggatggtcatgtaa
gtatatctaccacaccaaaagtaactgggaaaggacaggtatattttgtgaataagttta
aggaattacaggaaggtgttagagaaaggcaggcgacaaaatgaccaactcaagaaaaat
taaaataggtgtaggttcttctgtatcatgtttagatgatgaagaatacacattaaagga
actaggattaagtgaaaatgcaactgaggaagaaattacaaaagctgtatttgacatggt
ttgcgactatttagactggggatggagtgagattgagcatgaccacaaaagaaatgccta
aaagattctggaacattctgtattgcaacggtgttaacccaaacaattatacatttgtag
gctgtggctatcaggattttacaattaagagtaagaaaacaggcaaggtattgttgccga
ttaggtattaagcatgaagataaaggatttactaaactccaaggaatttggaaactgtac
agcaggagcaattgtaaaaacactatgttacccatatgatgatgcagattactatgtcaa
ttctttagaaggtttacccttaaataaatattccgaggaattggagagtatggaacgacc
atgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|431943.4.peg.1955 Clostridium kluyveri DSM 555 FIG   Phage antirepressor protein
gb|EDK33922.1 Clostridium kluyveri DSM 555     Predicted prophage antirepressor
gi|146347386 Clostridium kluyveri DSM 555 NCBI   Predicted prophage antirepressor
gi|153954528 Clostridium kluyveri DSM 555 NCBI   prophage antirepressor
img|640859149 Clostridium kluyveri DSM 555 IMG   Predicted prophage antirepressor
kegg|ckl:CKL_1910 Clostridium kluyveri DSM 555 KEGG   prophage antirepressor
ref|YP_001395293.1 Clostridium kluyveri DSM 555 RefSeq   prophage antirepressor
tr|A5MYH6 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) TrEMBL   Predicted prophage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search