The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.995: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Putative ATL autolysin transcription regulator
Translate Function Assignments



Context on contig NC_009641 from base 1014926 to 1025923 (10998 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
991 1016107 1014926 1182 -           Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 2 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 6 3   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 7 5 1   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556
997 1025298 1024864 435 - 227     1: 4   GNAT family acetyltransferase YjcF locus|NWMN_0923, protein_id|YP_001331957.1, gi|151221135, geneID|5331762
998 1025923 1025453 471 - 154         FIG01108206: hypothetical protein locus|NWMN_0924, protein_id|YP_001331958.1, gi|151221136, geneID|5330557

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.995 Putative ATL autolysin transcription regulator
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL

MD5 = 99bcc2acdf273e9c6c460776cc7ca4b2


  DNA Sequence

>fig|426430.8.peg.995 Putative ATL autolysin transcription regulator
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa


  DNA with Flanking Sequence

>fig|426430.8.peg.995 Putative ATL autolysin transcription regulator
gatcaaaaaccataacgcaaatactgggttaaaaggatcaagttgtaattcgtcactttt
acctgttaagaaataataaattgaaaagaatgcaaaaaatatcatataaggtactatcaa
acgttttgaaattttttctaaatagtatggtttatcaatatttttcgcgaaataaccaga
tataaacaaaaatgttggcatatggaaactataaataactaggtataatgctgataaata
tttatcgccactagtgtagggttgtaacatatgtccaaatacgactaataatattaaaat
tgctcttgcgttgtcaaaaaaataatctctctcttttaatgaagtcatattttatctcct
ttatgtccataagactcttactaatttattatattttgtattagttatgcaacaaatttg
tctattgtgtcgaatagtattgtaaaaattataaaaaaagcatataatattataaataat
atgtagtggagtagaacaacatgtataaacaacttgaaaaacttattacactgactaaca
atgacttaaacttagtgaatagaagatttggacaacgcacggatatcacatctgaacagc
tagaacttctccgtattttatttaattacgatcgcttatcacagtatgatttgacgatga
agattagcagggaacaatctatagtttcaaggtggattaagaaattagttttgaaagggt
acatcacaagtcaacaatctagcgaagatttaagatgtaaagaattaattttgactgatc
aagcacgtacattaatttcacaaataaataatgcacgttgcgaattgattgaagcaagat
gtcaatgtttatcggaagtcgaattagacaatttaaatcaattacttgataagttaaatc
aacgacgcatatcgttgtaacacgacaatagcaaacacataatttagtgtcgttgtgcac
acaacaaaaattgaatcatgaattacaagcaaaagtagcggtgattgttaaaattgatgg
taaacaatcaccgctatttttgcttgtgtatgtataaaaaagggatcaaaggtcatcccc
catgattgatagtgggggatgacttttgatcctatgttcatgttgcttatttatattgtg
ggatgtcgaagtatttgccgacttcgccaattttatcatagtagcctttgatgattttag
cattgatgttagcccaatctacatctgtagcatattggtgtgttcctggatgtgcaggat
tccatctcattttgtaaagtgtattttgaccagcttttacatatgagttgccgatgaatt
tagcaccaccaacgattgcttttgatactgtgtcccaaccagcttgtttagcatatttaa
taccttcacgtaaaggatcgttatcatatgcagcaatacc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005622       C:intracellular
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
cmr|NT01SA0983 Staphylococcus aureus N315     transcriptional regulator, MarR family family
cmr|NT02SA1040 Staphylococcus aureus Mu50     ATL autolysin transcription regulator
cmr|NT03SA1019 Staphylococcus aureus MW2     transcriptional regulator, MarR family
cmr|NT05SA0899 Staphylococcus aureus NCTC 8325     regulatory protein, MarR
cmr|NT08SA1003 Staphylococcus aureus subsp. aureus MRSA252     ATL autolysin transcription regulator
cmr|NT09SA0983 Staphylococcus aureus subsp. aureus MSSA476     ATL autolysin transcription regulator
cmr|SACOL1060 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, MarR family
dbj|BAB42149.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein, probable ATL autolysin transcription regulator
dbj|BAB57213.1 Staphylococcus aureus subsp. aureus Mu50     ATL autolysin transcription regulator
dbj|BAB94800.1 Staphylococcus aureus subsp. aureus MW2     MW0935
dbj|BAF67193.1 Staphylococcus aureus subsp. aureus str. Newman     ATL autolysin transcriptional regulator
dbj|BAF77927.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG40029.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   MarR family regulatory protein
emb|CAG42762.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   MarR family regulatory protein
fig|158878.1.peg.1051 Staphylococcus aureus subsp. aureus Mu50 FIG   Putative ATL autolysin transcription regulator
fig|158878.14.peg.1078 Staphylococcus aureus subsp. aureus Mu50 FIG   Putative ATL autolysin transcription regulator
fig|158879.1.peg.932 Staphylococcus aureus subsp. aureus N315 FIG   Putative ATL autolysin transcription regulator
fig|158879.11.peg.966 Staphylococcus aureus subsp. aureus N315 FIG   Putative ATL autolysin transcription regulator
fig|196620.1.peg.935 Staphylococcus aureus subsp. aureus MW2 FIG   Putative ATL autolysin transcription regulator
fig|196620.5.peg.980 Staphylococcus aureus subsp. aureus MW2 FIG   Putative ATL autolysin transcription regulator
fig|282458.1.peg.958 Staphylococcus aureus subsp. aureus MRSA252 FIG   Putative ATL autolysin transcription regulator
fig|282458.4.peg.1023 Staphylococcus aureus subsp. aureus MRSA252 FIG   Putative ATL autolysin transcription regulator
fig|282459.1.peg.979 Staphylococcus aureus subsp. aureus MSSA476 FIG   Putative ATL autolysin transcription regulator
fig|282459.5.peg.1022 Staphylococcus aureus subsp. aureus MSSA476 FIG   Putative ATL autolysin transcription regulator
fig|359786.13.peg.1183 Staphylococcus aureus subsp. aureus JH9 FIG   Putative ATL autolysin transcription regulator
fig|359786.3.peg.2357 Staphylococcus aureus subsp. aureus JH9 FIG   Putative ATL autolysin transcription regulator
fig|359787.11.peg.1164 Staphylococcus aureus subsp. aureus JH1 FIG   Putative ATL autolysin transcription regulator
fig|359787.3.peg.1596 Staphylococcus aureus subsp. aureus JH1 FIG   Putative ATL autolysin transcription regulator
fig|418127.6.peg.1061 Staphylococcus aureus subsp. aureus Mu3 FIG   Putative ATL autolysin transcription regulator
fig|450394.6.peg.244 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Putative ATL autolysin transcription regulator
fig|505321.3.peg.1738 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Putative ATL autolysin transcription regulator
fig|548470.3.peg.2591 Staphylococcus aureus subsp. aureus MN8 FIG   Putative ATL autolysin transcription regulator
fig|548473.3.peg.2303 Staphylococcus aureus subsp. aureus TCH60 FIG   Putative ATL autolysin transcription regulator
fig|548474.3.peg.1265 Staphylococcus aureus subsp. aureus TCH130 FIG   Putative ATL autolysin transcription regulator
fig|548475.3.peg.1282 Staphylococcus aureus subsp. aureus TCH70 FIG   Putative ATL autolysin transcription regulator
fig|553565.3.peg.1753 Staphylococcus aureus A5937 FIG   Putative ATL autolysin transcription regulator
fig|553568.3.peg.2239 Staphylococcus aureus A6224 FIG   Putative ATL autolysin transcription regulator
fig|553571.3.peg.1969 Staphylococcus aureus A6300 FIG   Putative ATL autolysin transcription regulator
fig|553573.3.peg.1097 Staphylococcus aureus A8115 FIG   Putative ATL autolysin transcription regulator
fig|553577.3.peg.1518 Staphylococcus aureus A8796 FIG   Putative ATL autolysin transcription regulator
fig|553580.3.peg.998 Staphylococcus aureus A8819 FIG   Putative ATL autolysin transcription regulator
fig|553581.3.peg.1009 Staphylococcus aureus A9299 FIG   Putative ATL autolysin transcription regulator
fig|553583.3.peg.1069 Staphylococcus aureus A9635 FIG   Putative ATL autolysin transcription regulator
fig|553588.3.peg.2166 Staphylococcus aureus A9719 FIG   Putative ATL autolysin transcription regulator
fig|553592.3.peg.199 Staphylococcus aureus A9763 FIG   Putative ATL autolysin transcription regulator
fig|553596.3.peg.2139 Staphylococcus aureus A9781 FIG   Putative ATL autolysin transcription regulator
fig|553601.3.peg.902 Staphylococcus aureus A10102 FIG   Putative ATL autolysin transcription regulator
fig|585143.3.peg.1501 Staphylococcus aureus subsp. aureus 55/2053 FIG   Putative ATL autolysin transcription regulator
fig|585144.3.peg.1869 Staphylococcus aureus subsp. aureus 58-424 FIG   Putative ATL autolysin transcription regulator
fig|585145.3.peg.1493 Staphylococcus aureus subsp. aureus 65-1322 FIG   Putative ATL autolysin transcription regulator
fig|585146.3.peg.1498 Staphylococcus aureus subsp. aureus 68-397 FIG   Putative ATL autolysin transcription regulator
fig|585147.3.peg.533 Staphylococcus aureus subsp. aureus A017934/97 FIG   Putative ATL autolysin transcription regulator
fig|585148.3.peg.532 Staphylococcus aureus subsp. aureus Btn1260 FIG   Putative ATL autolysin transcription regulator
fig|585149.6.peg.1135 Staphylococcus aureus subsp. aureus C101 FIG   Putative ATL autolysin transcription regulator
fig|585150.3.peg.1558 Staphylococcus aureus subsp. aureus C160 FIG   Putative ATL autolysin transcription regulator
fig|585151.3.peg.588 Staphylococcus aureus subsp. aureus C427 FIG   Putative ATL autolysin transcription regulator
fig|585152.3.peg.900 Staphylococcus aureus subsp. aureus D139 FIG   Putative ATL autolysin transcription regulator
fig|585153.3.peg.1559 Staphylococcus aureus subsp. aureus E1410 FIG   Putative ATL autolysin transcription regulator
fig|585154.3.peg.968 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Putative ATL autolysin transcription regulator
fig|585155.3.peg.2322 Staphylococcus aureus subsp. aureus H19 FIG   Putative ATL autolysin transcription regulator
fig|585156.3.peg.517 Staphylococcus aureus subsp. aureus M1015 FIG   Putative ATL autolysin transcription regulator
fig|585157.3.peg.639 Staphylococcus aureus subsp. aureus M809 FIG   Putative ATL autolysin transcription regulator
fig|585158.3.peg.1487 Staphylococcus aureus subsp. aureus M876 FIG   Putative ATL autolysin transcription regulator
fig|585159.3.peg.1102 Staphylococcus aureus subsp. aureus M899 FIG   Putative ATL autolysin transcription regulator
fig|585160.3.peg.514 Staphylococcus aureus subsp. aureus WBG10049 FIG   Putative ATL autolysin transcription regulator
fig|585161.3.peg.719 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Putative ATL autolysin transcription regulator
fig|585891.3.peg.1075 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Putative ATL autolysin transcription regulator
fig|680649.3.peg.2429 Staphylococcus aureus subsp. aureus MR1 FIG   Putative ATL autolysin transcription regulator
fig|681288.4.peg.1020 Staphylococcus aureus subsp. aureus ED98 FIG   Putative ATL autolysin transcription regulator
fig|703339.3.peg.1020 Staphylococcus aureus 04-02981 FIG   Putative ATL autolysin transcription regulator
fig|762962.3.peg.1017 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Putative ATL autolysin transcription regulator
fig|93061.3.peg.953 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative ATL autolysin transcription regulator
fig|93061.5.peg.911 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative ATL autolysin transcription regulator
fig|93062.19.peg.1031 Staphylococcus aureus subsp. aureus COL FIG   Putative ATL autolysin transcription regulator
fig|93062.4.peg.1229 Staphylococcus aureus subsp. aureus COL FIG   Putative ATL autolysin transcription regulator
gb|AAW36525.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, MarR family
gb|ABD30116.1 Staphylococcus aureus subsp. aureus NCTC 8325     transcriptional regulator, MarR family, putative
gb|ABQ48910.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, MarR family
gb|ABR51987.1 Staphylococcus aureus subsp. aureus JH1     regulatory protein MarR
gb|EEI94449.1 Staphylococcus aureus subsp. aureus MN8     MarR family transcriptional regulator
gb|EEJ60978.1 Staphylococcus aureus subsp. aureus TCH60     MarR family transcriptional regulator
gb|EES55297.1 Staphylococcus aureus subsp. aureus TCH70     MarR family transcriptional regulator
gb|EES93387.1 Staphylococcus aureus subsp. aureus USA300_TCH959     MarR family transcriptional regulator
gb|EES98094.1 Staphylococcus aureus subsp. aureus TCH130     MarR family transcriptional regulator
gb|EEV04214.1 Staphylococcus aureus subsp. aureus 55/2053     transcriptional regulator
gb|EEV06097.1 Staphylococcus aureus subsp. aureus 65-1322     MarR family transcriptional regulator
gb|EEV09150.1 Staphylococcus aureus subsp. aureus 68-397     MarR family regulatory protein
gb|EEV11336.1 Staphylococcus aureus subsp. aureus E1410     MarR family regulatory protein
gb|EEV14406.1 Staphylococcus aureus subsp. aureus M876     transcriptional regulator
gb|EEV27528.1 Staphylococcus aureus A9781     transcriptional regulator
gb|EEV65675.1 Staphylococcus aureus A9763     transcriptional regulator
gb|EEV66594.1 Staphylococcus aureus A9719     ATL autolysin transcription regulator
gb|EEV70278.1 Staphylococcus aureus A9635     transcriptional regulator
gb|EEV72875.1 Staphylococcus aureus A9299     MarR family transcriptional regulator
gb|EEV75343.1 Staphylococcus aureus A8115     transcriptional regulator
gb|EEV77205.1 Staphylococcus aureus A6300     regulatory protein MarR
gb|EEV79724.1 Staphylococcus aureus A6224     transcriptional regulator
gb|EEV85644.1 Staphylococcus aureus A5937     ATL autolysin transcriptional regulator
gi|13700853 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein, probable ATL autolysin transcription regulator
gi|14246821 Staphylococcus aureus subsp. aureus Mu50 NCBI   ATL autolysin transcription regulator
gi|147740612 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, MarR family
gi|148267543 Staphylococcus aureus subsp. aureus JH9 NCBI   MarR family transcriptional regulator
gi|149946051 Staphylococcus aureus subsp. aureus JH1 NCBI   regulatory protein MarR
gi|150373933 Staphylococcus aureus subsp. aureus str. Newman NCBI   ATL autolysin transcriptional regulator
gi|150393599 Staphylococcus aureus subsp. aureus JH1 NCBI   regulatory protein MarR
gi|151221133 Staphylococcus aureus subsp. aureus str. Newman NCBI   ATL autolysin transcriptional regulator
gi|156721510 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979375 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1044
gi|15924041 Staphylococcus aureus subsp. aureus Mu50 NCBI   ATL autolysin transcription regulator
gi|15926638 Staphylococcus aureus subsp. aureus N315 NCBI   ATL autolysin transcription regulator
gi|21204102 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0935
gi|21282664 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0935
gi|227244690 Staphylococcus aureus subsp. aureus MN8 NCBI   MarR family transcriptional regulator
gi|227558905 Staphylococcus aureus subsp. aureus MN8 NCBI   MarR family transcriptional regulator
gi|227851180 Staphylococcus aureus subsp. aureus TCH60 NCBI   MarR family transcriptional regulator
gi|227900530 Staphylococcus aureus subsp. aureus TCH60 NCBI   MarR family transcriptional regulator
gi|251802640 Staphylococcus aureus subsp. aureus TCH70 NCBI   MarR family transcriptional regulator
gi|251813950 Staphylococcus aureus subsp. aureus TCH70 NCBI   MarR family transcriptional regulator
gi|253316209 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08732
gi|253724658 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MarR family transcriptional regulator
gi|253729365 Staphylococcus aureus subsp. aureus TCH130 NCBI   MarR family transcriptional regulator
gi|253731659 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MarR family transcriptional regulator
gi|253732587 Staphylococcus aureus subsp. aureus TCH130 NCBI   MarR family transcriptional regulator
gi|255005839 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05200
gi|257272082 Staphylococcus aureus subsp. aureus 55/2053 NCBI   transcriptional regulator
gi|257274610 Staphylococcus aureus subsp. aureus 65-1322 NCBI   MarR family transcriptional regulator
gi|257278531 Staphylococcus aureus subsp. aureus 68-397 NCBI   MarR family regulatory protein
gi|257281199 Staphylococcus aureus subsp. aureus E1410 NCBI   MarR family regulatory protein
gi|257284286 Staphylococcus aureus subsp. aureus M876 NCBI   transcriptional regulator
gi|257425106 Staphylococcus aureus subsp. aureus 55/2053 NCBI   transcriptional regulator
gi|257427769 Staphylococcus aureus subsp. aureus 65-1322 NCBI   MarR family transcriptional regulator
gi|257430403 Staphylococcus aureus subsp. aureus 68-397 NCBI   MarR family regulatory protein
gi|257433106 Staphylococcus aureus subsp. aureus E1410 NCBI   MarR family regulatory protein
gi|257436004 Staphylococcus aureus subsp. aureus M876 NCBI   transcriptional regulator
gi|257789188 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257795216 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257841230 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|257842166 Staphylococcus aureus A9719 NCBI   ATL autolysin transcription regulator
gi|257846254 Staphylococcus aureus A9635 NCBI   transcriptional regulator
gi|257848892 Staphylococcus aureus A9299 NCBI   MarR family transcriptional regulator
gi|257851404 Staphylococcus aureus A8115 NCBI   transcriptional regulator
gi|257854255 Staphylococcus aureus A6300 NCBI   regulatory protein MarR
gi|257856821 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|257862879 Staphylococcus aureus A5937 NCBI   ATL autolysin transcriptional regulator
gi|258407075 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|258421833 Staphylococcus aureus A9719 NCBI   ATL autolysin transcription regulator
gi|258423553 Staphylococcus aureus A9635 NCBI   transcriptional regulator
gi|258435231 Staphylococcus aureus A9299 NCBI   MarR family transcriptional regulator
gi|258443314 Staphylococcus aureus A8115 NCBI   transcriptional regulator
gi|258446923 Staphylococcus aureus A6300 NCBI   regulatory protein MarR
gi|258449901 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|258454999 Staphylococcus aureus A5937 NCBI   ATL autolysin transcriptional regulator
gi|49241345 Staphylococcus aureus subsp. aureus MRSA252 NCBI   MarR family regulatory protein
gi|49244334 Staphylococcus aureus subsp. aureus MSSA476 NCBI   MarR family regulatory protein
gi|49483216 Staphylococcus aureus subsp. aureus MRSA252 NCBI   MarR family regulatory protein
gi|49485891 Staphylococcus aureus subsp. aureus MSSA476 NCBI   MarR family regulatory protein
gi|57284431 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator, MarR family
gi|57650245 Staphylococcus aureus subsp. aureus COL NCBI   MarR family transcriptional regulator
gi|87202306 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transcriptional regulator, MarR family, putative
gi|88194748 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   MarR family transcriptional regulator
img|637092551 Staphylococcus aureus aureus N315 IMG   hypothetical protein, probable ATL autolysin transcription regulator
img|637099565 Staphylococcus aureus aureus Mu50 IMG   ATL autolysin transcription regulator
img|637151824 Staphylococcus aureus aureus COL IMG   transcriptional regulator, MarR family
img|637154464 Staphylococcus aureus aureus MRSA252 IMG   MarR family regulatory protein
img|637157215 Staphylococcus aureus aureus MSSA476 IMG   MarR family regulatory protein
img|637298698 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637893637 Staphylococcus aureus aureus NCTC 8325 IMG   transcriptional regulator, MarR family, putative
img|639109242 Staphylococcus aureus aureus JH1 IMG   regulatory protein, MarR
img|640565461 Staphylococcus aureus aureus JH9 IMG   transcriptional regulator, MarR family
img|640779220 Staphylococcus aureus aureus JH1 IMG   regulatory protein MarR
img|640795301 Staphylococcus aureus aureus Newman IMG   ATL autolysin transcriptional regulator
img|640903787 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sac:SACOL1060 Staphylococcus aureus subsp. aureus COL KEGG   MarR family transcriptional regulator
kegg|sae:NWMN_0921 Staphylococcus aureus subsp. aureus Newman KEGG   ATL autolysin transcriptional regulator
kegg|sah:SaurJH1_1133 Staphylococcus aureus subsp. aureus JH1 KEGG   regulatory protein MarR
kegg|saj:SaurJH9_1110 Staphylococcus aureus subsp. aureus JH9 KEGG   MarR family transcriptional regulator
kegg|sam:MW0935 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00992 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   MarR family transcriptional regulator
kegg|sar:SAR1025   KEGG   MarR family regulatory protein
kegg|sas:SAS0987   KEGG   MarR family regulatory protein
kegg|sau:SA0904   KEGG   ATL autolysin transcription regulator
kegg|sav:SAV1051   KEGG   ATL autolysin transcription regulator
kegg|saw:SAHV_1044 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371575.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   ATL autolysin transcription regulator
ref|NP_374171.1 Staphylococcus aureus subsp. aureus N315 RefSeq   ATL autolysin transcription regulator
ref|NP_645752.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0935
ref|YP_001246486.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   MarR family transcriptional regulator
ref|YP_001316274.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   regulatory protein MarR
ref|YP_001331955.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   ATL autolysin transcriptional regulator
ref|YP_001441634.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1044
ref|YP_040440.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   MarR family regulatory protein
ref|YP_043112.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   MarR family regulatory protein
ref|YP_185925.1 Staphylococcus aureus subsp. aureus COL RefSeq   MarR family transcriptional regulator
ref|YP_499544.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   MarR family transcriptional regulator
ref|ZP_03988952.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   MarR family transcriptional regulator
ref|ZP_04018335.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   MarR family transcriptional regulator
ref|ZP_04828423.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   MarR family transcriptional regulator
ref|ZP_04839422.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08732
ref|ZP_04865824.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   MarR family transcriptional regulator
ref|ZP_04866752.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   MarR family transcriptional regulator
ref|ZP_05144440.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05200
ref|ZP_05601532.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   transcriptional regulator
ref|ZP_05604167.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   MarR family transcriptional regulator
ref|ZP_05606785.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   MarR family regulatory protein
ref|ZP_05609464.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   MarR family regulatory protein
ref|ZP_05612051.1 Staphylococcus aureus subsp. aureus M876 RefSeq   transcriptional regulator
ref|ZP_05644195.1 Staphylococcus aureus A9781 RefSeq   transcriptional regulator
ref|ZP_05680224.1 Staphylococcus aureus A9763 RefSeq   transcriptional regulator
ref|ZP_05684754.1 Staphylococcus aureus A9719 RefSeq   ATL autolysin transcription regulator
ref|ZP_05686443.1 Staphylococcus aureus A9635 RefSeq   transcriptional regulator
ref|ZP_05688970.1 Staphylococcus aureus A9299 RefSeq   MarR family transcriptional regulator
ref|ZP_05691657.1 Staphylococcus aureus A8115 RefSeq   transcriptional regulator
ref|ZP_05695076.1 Staphylococcus aureus A6300 RefSeq   regulatory protein MarR
ref|ZP_05697999.1 Staphylococcus aureus A6224 RefSeq   transcriptional regulator
ref|ZP_05702962.1 Staphylococcus aureus A5937 RefSeq   ATL autolysin transcriptional regulator
tr|A5IRT7 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, MarR family
tr|A6QFR1 Staphylococcus aureus (strain Newman) TrEMBL   ATL autolysin transcriptional regulator
tr|A6U0L9 Staphylococcus aureus (strain JH1) TrEMBL   Regulatory protein MarR
tr|A7X0T8 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C2GDA2 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   MarR family transcriptional regulator
tr|C2KA12 Staphylococcus aureus subsp. aureus MN8 TrEMBL   MarR family transcriptional regulator
tr|C5N4D2 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   MarR family transcriptional regulator
tr|C5PXY3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   MarR family transcriptional regulator
tr|C5QI07 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   MarR family transcriptional regulator
tr|Q2FZK9 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Transcriptional regulator, MarR family, putative
tr|Q5HH32 Staphylococcus aureus (strain COL) TrEMBL   Transcriptional regulator, MarR family
tr|Q6GAG1 Staphylococcus aureus (strain MSSA476) TrEMBL   MarR family regulatory protein
tr|Q6GI32 Staphylococcus aureus (strain MRSA252) TrEMBL   MarR family regulatory protein
tr|Q7A187 Staphylococcus aureus (strain MW2) TrEMBL   MW0935 protein
tr|Q7A6A4 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0904
tr|Q99V42 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   ATL autolysin transcription regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search