The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.993: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
Translate Function Assignments



Context on contig NC_009641 from base 1012703 to 1024636 (11934 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
988 1012703 1013506 804 +       2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8     2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 6 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 5 8   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 7 4 3   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Lysine_Biosynthesis_DAP_Pathway AndreiO N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
Lysine_biosynthesis_PanGenomes Acharya_Geeta_user N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)


  Protein Sequence

>fig|426430.8.peg.993 N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
ISYAYEMDVLKEGMKRLAKYLNTK

MD5 = 0782fa7f9a045ddc817a9f43c56f7ff9


  DNA Sequence

>fig|426430.8.peg.993 N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
atgaaactttctttaaattctaattctaaatatttaagagcaccaagtattcgccaattt
tcaaatcgtatgaataatttggatgattgtgttaatttaactattggccaaccagacttc
ccgatgcctgatgttgtgaaaaaggcatatattgatgctattaacaatgacaagacatca
tactctcacaataaagggttattagaaactcgcgaagcaattagtcaatacttcaaaaat
cgttatcatttttcctatgatcctgaagaaattattgtgacaaatggagcaagtgaagca
atagacacaacgttacgttctatcatagagcctggagatgaaattataataccgggacca
atttatgcaggctacataccactcatcgaagtactaggtggtaaaccaatttatattgat
acaacagcaacacaatttaaaattacacctgatgcattagaaagtcatatttctccaaag
acaaaagctgtcttgttaaattatccgactaatccaactggcgtagttttaaaaagaaat
gaagttttaaatatcgtaaatgtattaaaaaaatatccgttatttattattagcgatgag
atttatgctgaaaatacatttagtggtaaacatgtatccttcgctgaatttgaagacatt
cgtgatcaattaatattaattggtggtttaagtaaatcacactcagcaaccggaataaga
attggttttctattaggacctcaatatttgattgataaattaacatttatgcacgcctat
aattgtatttgtgccaatgttccagctcaaatagcatgtataacagcacttaacgaagga
ttagaagctcctaaatatatgaacgaagcttatgtagaacgaagaaattatttagtatct
gaattaactaaattaggttttgagattaccgctcaacctgaaggcgcgttttatattttc
ccaagtattaaacatatcaccgatgacgatttcgaattttgtgtcgatttacttgaatca
acacatttagcaatcgttccaggctcatcctttacagaattcggtaaaggatttgtaagg
atttcctatgcttatgaaatggatgttttaaaagaaggtatgaagagacttgctaaatat
ttaaatactaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.993 N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
ttatattatatggaattatattaatcgcaatgactgcgtttctaaatttaatgtcaacaa
agaaaaaattatatacttatattggtagtcgtacgctatacgtatatttattacatggtt
taattattggcattgttagaggatttgaatggtacccattcgataatcctatatcattaa
tgacttatctttatttaataagtatatctgtaatcatcgtatatgtattatctacaaact
ttgtttgtaaatggacaaatccaataattaatttacaaagaccatcacagtttaaagatt
cataattttatactgtctaagtacattaactgtaaccactttattcattttgaaaagtag
ttactacagtgtatttagacatttttcgtttttcaaataaagcttaagtaatttaccctt
ttttgctttaaaagtatgttatgatattattaatttctaaatttttagacaatatttgat
ttatatttgaggtgtcacaaatgaaactttctttaaattctaattctaaatatttaagag
caccaagtattcgccaattttcaaatcgtatgaataatttggatgattgtgttaatttaa
ctattggccaaccagacttcccgatgcctgatgttgtgaaaaaggcatatattgatgcta
ttaacaatgacaagacatcatactctcacaataaagggttattagaaactcgcgaagcaa
ttagtcaatacttcaaaaatcgttatcatttttcctatgatcctgaagaaattattgtga
caaatggagcaagtgaagcaatagacacaacgttacgttctatcatagagcctggagatg
aaattataataccgggaccaatttatgcaggctacataccactcatcgaagtactaggtg
gtaaaccaatttatattgatacaacagcaacacaatttaaaattacacctgatgcattag
aaagtcatatttctccaaagacaaaagctgtcttgttaaattatccgactaatccaactg
gcgtagttttaaaaagaaatgaagttttaaatatcgtaaatgtattaaaaaaatatccgt
tatttattattagcgatgagatttatgctgaaaatacatttagtggtaaacatgtatcct
tcgctgaatttgaagacattcgtgatcaattaatattaattggtggtttaagtaaatcac
actcagcaaccggaataagaattggttttctattaggacctcaatatttgattgataaat
taacatttatgcacgcctataattgtatttgtgccaatgttccagctcaaatagcatgta
taacagcacttaacgaaggattagaagctcctaaatatatgaacgaagcttatgtagaac
gaagaaattatttagtatctgaattaactaaattaggttttgagattaccgctcaacctg
aaggcgcgttttatattttcccaagtattaaacatatcaccgatgacgatttcgaatttt
gtgtcgatttacttgaatcaacacatttagcaatcgttccaggctcatcctttacagaat
tcggtaaaggatttgtaaggatttcctatgcttatgaaatggatgttttaaaagaaggta
tgaagagacttgctaaatatttaaatactaaataaaaatgatatgttgaactggacgtcg
tgaactaaattcatagtacgttcagttttttatattctataagttttaaataatactcta
tagagactgtaaatactaccgagttatattcctctcctttaaacacctcactcaaaatga
ttctatcaaaaggttttaatatgctaacttataattgttcttcgaaacttaagcactcaa
ataatatatcaccattcatattaatctacctttggccaaacaattattattcaaaagtta
ctatttattattataaacaaatactttccattcgctctcaattcctttcttatttattct
tttagataaatgcaaacaattgacgatcttatcaatttaactcaattgaataaagtataa
tacaattcaattttaattcccttaatgtttttgtaaactctaatctttacaaaaactttt
taatttatttatatattcttattgacttaaaaatttttagtgttatatttaactt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008483       F:transaminase activity
GO:0009058       P:biosynthetic process
GO:0016847       F:1-aminocyclopropane-1-carboxylate synthase ...
GO:0030170       F:pyridoxal phosphate binding
cmr|SACOL1058 Staphylococcus aureus subsp. aureus COL     aminotransferase, class I
cmr|SAUSA300_0952 Staphylococcus aureus subsp. aureus USA300-FPR3757     aminotransferase, class I
dbj|BAF67191.1 Staphylococcus aureus subsp. aureus str. Newman     aminotransferase, class I
fig|367830.3.peg.1517 Staphylococcus aureus subsp. aureus USA300 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|426430.6.peg.888 Staphylococcus aureus subsp. aureus str. Newman FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|450394.6.peg.242 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|451515.3.peg.1045 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|451516.9.peg.1049 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|452948.4.peg.2061 Staphylococcus aureus 930918-3 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|455227.3.peg.1409 Staphylococcus aureus D30 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|546342.3.peg.1019 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|546343.3.peg.1886 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|553567.3.peg.1500 Staphylococcus aureus A5948 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|553590.4.peg.93 Staphylococcus aureus A9754 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|553594.3.peg.2032 Staphylococcus aureus A9765 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|644279.4.peg.1054 Staphylococcus aureus subsp. aureus 132 FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|93062.19.peg.1029 Staphylococcus aureus subsp. aureus COL FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
fig|93062.4.peg.1227 Staphylococcus aureus subsp. aureus COL FIG   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-)
gb|AAW36523.1 Staphylococcus aureus subsp. aureus COL     aminotransferase, class I
gb|ABD21081.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     aminotransferase, class I
gb|EES93385.1 Staphylococcus aureus subsp. aureus USA300_TCH959     possible aspartate transaminase
gb|EEV83048.1 Staphylococcus aureus A5948     aminotransferase
gb|EEW44335.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1107
gb|EEW47068.1 Staphylococcus aureus D30     hypothetical protein SAD30_2041
gi|150373931 Staphylococcus aureus subsp. aureus str. Newman NCBI   aminotransferase, class I
gi|151221131 Staphylococcus aureus subsp. aureus str. Newman NCBI   aminotransferase, class I
gi|221138027 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   aminotransferase, class I
gi|221141833 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   aminotransferase, class I
gi|253724656 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   possible aspartate transaminase
gi|253731657 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   possible aspartate transaminase
gi|257860216 Staphylococcus aureus A5948 NCBI   aminotransferase
gi|258452001 Staphylococcus aureus A5948 NCBI   aminotransferase
gi|259159277 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1107
gi|259162499 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2041
gi|57284429 Staphylococcus aureus subsp. aureus COL NCBI   aminotransferase, class I
gi|57650243 Staphylococcus aureus subsp. aureus COL NCBI   aminotransferase, class I
gi|87126567 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aminotransferase, class I
gi|87160593 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aminotransferase, class I
img|637151822 Staphylococcus aureus aureus COL IMG   aminotransferase, class I
img|637887604 Staphylococcus aureus aureus USA300 IMG   aminotransferase, class I( EC:2.6.1.- )
img|640795299 Staphylococcus aureus aureus Newman IMG   aminotransferase, class I
img|641772572 Staphylococcus aureus aureus USA300_TCH959 IMG   aminotransferase, class I
kegg|saa:SAUSA300_0952 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   aminotransferase, class I (EC:2.6.1.-)
kegg|sac:SACOL1058 Staphylococcus aureus subsp. aureus COL KEGG   aminotransferase, class I
kegg|sae:NWMN_0919 Staphylococcus aureus subsp. aureus Newman KEGG   aminotransferase, class I
ref|YP_001331953.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   aminotransferase, class I
ref|YP_185923.1 Staphylococcus aureus subsp. aureus COL RefSeq   aminotransferase, class I
ref|YP_493650.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   aminotransferase, class I
ref|ZP_03562829.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   aminotransferase, class I
ref|ZP_03566326.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   aminotransferase, class I
ref|ZP_04865822.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   possible aspartate transaminase
ref|ZP_05700017.1 Staphylococcus aureus A5948 RefSeq   aminotransferase
tr|A6QFQ9 Staphylococcus aureus (strain Newman) TrEMBL   Aminotransferase, class I
tr|C5N4D0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Possible aspartate transaminase
tr|Q2FI28 Staphylococcus aureus (strain USA300) TrEMBL   Aminotransferase, class I
tr|Q5HH34 Staphylococcus aureus (strain COL) TrEMBL   Aminotransferase, class I


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search