The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.992: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
Translate Function Assignments



Context on contig NC_009641 from base 1011043 to 1024636 (13594 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
987 1011043 1012716 1674 +       2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|memD, locus|NWMN_0913, protein_id|YP_001331947.1, gi|151221125, geneID|5330552
988 1012703 1013506 804 + -14     2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8     2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 6 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 5 8   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 7 4 3   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
EC_3.4.21.-_Serine_endopeptidase gjo Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA


  Protein Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
PDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA

MD5 = d27b8bab4626acd15d52733c1796379b


  DNA Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
atgaaaggtaaatttttaaaagttagttctttattcgttgcaactttgacaacagcgaca
cttgtgagttctccagcagcaaacgcgttatcttcaaaggctatggacaatcatccacaa
caaacgcagtcaagcaaacagcaaacacctaagattcaaaaaggcggtaaccttaaacca
ttagaacaacgtgaacacgcaaatgttatattaccaaataacgatcgtcaccaaatcaca
gatacaacgaatggtcattatgcacccgtaacttatattcaagttgaagcacctactggt
acatttattgcttccggtgtagttgtaggtaaagatactcttttaacaaataaacacgtc
gtagatgctacgcacggtgatcctcatgctttaaaagcattcccttctgcaattaaccaa
gacaattatccaaatggtggtttcactgctgaacaaatcactaaatattcaggcgaaggt
gatttagcaatagttaaattctcccctaatgagcaaaacaaacatattggtgaagtagtt
aaaccagcaacaatgagtaataatgctgaaacacaagttaaccaaaatattactgtaaca
ggatatcctggtgataaacctgtagcaacaatgtgggaaagtaaaggaaaaatcacttac
ctcaaaggcgaagctatgcaatatgatttaagtacaactggtggtaattcaggttcacct
gtatttaatgaaaaaaatgaagtgatcggaattcattggggcggtgtaccaaatgaattt
aatggtgcggtatttattaatgaaaatgtacgcaacttcttaaaacaaaatattgaagat
atccattttgccaacgatgaccaacctaataacccagataatcctgataaccctaacaat
cctgataaccctaacaacccagatgaaccaaataaccctgacaaccctaacaaccctgat
aatccagacaatggcgataacaataattcagacaatccagatgcagcttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
aactaaattcatagtacgttcagttttttatattctataagttttaaataatactctata
gagactgtaaatactaccgagttatattcctctcctttaaacacctcactcaaaatgatt
ctatcaaaaggttttaatatgctaacttataattgttcttcgaaacttaagcactcaaat
aatatatcaccattcatattaatctacctttggccaaacaattattattcaaaagttact
atttattattataaacaaatactttccattcgctctcaattcctttcttatttattcttt
tagataaatgcaaacaattgacgatcttatcaatttaactcaattgaataaagtataata
caattcaattttaattcccttaatgtttttgtaaactctaatctttacaaaaacttttta
atttatttatatattcttattgacttaaaaatttttagtgttatatttaacttgtaaata
aattttttggaggtttttagatgaaaggtaaatttttaaaagttagttctttattcgttg
caactttgacaacagcgacacttgtgagttctccagcagcaaacgcgttatcttcaaagg
ctatggacaatcatccacaacaaacgcagtcaagcaaacagcaaacacctaagattcaaa
aaggcggtaaccttaaaccattagaacaacgtgaacacgcaaatgttatattaccaaata
acgatcgtcaccaaatcacagatacaacgaatggtcattatgcacccgtaacttatattc
aagttgaagcacctactggtacatttattgcttccggtgtagttgtaggtaaagatactc
ttttaacaaataaacacgtcgtagatgctacgcacggtgatcctcatgctttaaaagcat
tcccttctgcaattaaccaagacaattatccaaatggtggtttcactgctgaacaaatca
ctaaatattcaggcgaaggtgatttagcaatagttaaattctcccctaatgagcaaaaca
aacatattggtgaagtagttaaaccagcaacaatgagtaataatgctgaaacacaagtta
accaaaatattactgtaacaggatatcctggtgataaacctgtagcaacaatgtgggaaa
gtaaaggaaaaatcacttacctcaaaggcgaagctatgcaatatgatttaagtacaactg
gtggtaattcaggttcacctgtatttaatgaaaaaaatgaagtgatcggaattcattggg
gcggtgtaccaaatgaatttaatggtgcggtatttattaatgaaaatgtacgcaacttct
taaaacaaaatattgaagatatccattttgccaacgatgaccaacctaataacccagata
atcctgataaccctaacaatcctgataaccctaacaacccagatgaaccaaataaccctg
acaaccctaacaaccctgataatccagacaatggcgataacaataattcagacaatccag
atgcagcttaattaacaattaagttcgtctagataaaatagaagcaaagtcttagcaacg
taaaatattttgatttaaatggagggtattatatgaatagttcatgtaaatctagagtat
tcaatattataagcatcataatggtttcaatgcttattttatcactaggcgcatttgcta
ataacaataaagccaaagccgattcacactctaaacagctagaaattaatgttaagagtg
acaaagtacctcaaaaagtaaaagatctagcacaacaacaatttgctggttatgctaaag
cattagataaacaaagtaatgcaaaaactggtaaatatgaacttggcgaagcttttaaaa
tttataaatttaatggtgaagaagataatagttactattatccagttataaaagacggta
aaattgtttatactttaacacttagtcctaaaaataaagatgatttaaacaaatcaaaag
aagacatgaattacagtgttaaaatttcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004252       F:serine-type endopeptidase activity
GO:0005576       C:extracellular region
GO:0006508       P:proteolysis
GO:0009405       P:pathogenesis
cmr|NT05SA0896 Staphylococcus aureus NCTC 8325     glutamyl endopeptidase
cmr|SAUSA300_0951 Staphylococcus aureus subsp. aureus USA300-FPR3757     V8 protease
dbj|BAF67190.1 Staphylococcus aureus subsp. aureus str. Newman     V8 protease, glutamyl endopeptidase precursor
emb|CAA68434.1 Staphylococcus aureus EMBL   unnamed protein product
fig|367830.3.peg.1516 Staphylococcus aureus subsp. aureus USA300 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|426430.6.peg.887 Staphylococcus aureus subsp. aureus str. Newman FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|451515.3.peg.1044 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|451516.9.peg.1048 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|546342.3.peg.1018 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|546343.3.peg.1885 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553567.3.peg.1501 Staphylococcus aureus A5948 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553590.4.peg.92 Staphylococcus aureus A9754 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553594.3.peg.2031 Staphylococcus aureus A9765 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|644279.4.peg.1053 Staphylococcus aureus subsp. aureus 132 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|93061.3.peg.950 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|93061.5.peg.908 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
gb|AAG45843.1 Staphylococcus aureus     SspA
gb|ABD21260.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     V8 protease
gb|ABD30113.1 Staphylococcus aureus subsp. aureus NCTC 8325     glutamyl endopeptidase precursor, putative
gb|ABX29016.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     S01 family glutamyl endopeptidase
gb|AF309515_1 Staphylococcus aureus     SspA
gb|EEV83049.1 Staphylococcus aureus A5948     serine protease
gi|114152162 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
gi|114152163 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
gi|12025238 Staphylococcus aureus NCBI   SspA
gi|150373930 Staphylococcus aureus subsp. aureus str. Newman NCBI   V8 protease, glutamyl endopeptidase precursor
gi|151221130 Staphylococcus aureus subsp. aureus str. Newman NCBI   V8 protease, glutamyl endopeptidase precursor
gi|160368045 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   S01 family glutamyl endopeptidase
gi|161509236 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glutamyl endopeptidase
gi|221138026 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glutamyl endopeptidase precursor
gi|221141832 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glutamyl endopeptidase precursor
gi|257860217 Staphylococcus aureus A5948 NCBI   serine protease
gi|258452002 Staphylococcus aureus A5948 NCBI   serine protease
gi|46687 Staphylococcus aureus NCBI   unnamed protein product
gi|87126746 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   V8 protease
gi|87160772 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   V8 protease
gi|87202303 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamyl endopeptidase precursor, putative
gi|88194745 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamyl endopeptidase precursor, putative
img|637887603 Staphylococcus aureus aureus USA300 IMG   V8 protease( EC:3.4.21.19 )
img|637893634 Staphylococcus aureus aureus NCTC 8325 IMG   glutamyl endopeptidase precursor, putative
img|640795298 Staphylococcus aureus aureus Newman IMG   V8 protease, glutamyl endopeptidase precursor
img|641308966 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   S01 family glutamyl endopeptidase( EC:3.4.21.19 )
img|641772570 Staphylococcus aureus aureus USA300_TCH959 IMG   S01 family glutamyl endopeptidase
kegg|saa:SAUSA300_0951 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   V8 protease (EC:3.4.21.19)
kegg|sae:NWMN_0918 Staphylococcus aureus subsp. aureus Newman KEGG   V8 protease, glutamyl endopeptidase precursor
kegg|sao:SAOUHSC_00988 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   glutamyl endopeptidase precursor, putative
kegg|sax:USA300HOU_0996 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glutamyl endopeptidase (EC:3.4.21.19)
ref|YP_001331952.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   V8 protease, glutamyl endopeptidase precursor
ref|YP_001574895.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glutamyl endopeptidase
ref|YP_493649.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   V8 protease
ref|YP_499541.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   glutamyl endopeptidase precursor, putative
ref|ZP_03562828.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glutamyl endopeptidase precursor
ref|ZP_03566325.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glutamyl endopeptidase precursor
ref|ZP_05700018.1 Staphylococcus aureus A5948 RefSeq   serine protease
sp|P0C1U8 Staphylococcus aureus SwissProt   Glutamyl endopeptidase precursor
sp|Q2FZL2 Staphylococcus aureus (strain NCTC 8325) SwissProt   Glutamyl endopeptidase precursor
sp|SSPA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
sp|SSPA_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
tr|A6QFQ8 Staphylococcus aureus (strain Newman) TrEMBL   V8 protease, glutamyl endopeptidase
tr|A8Z0E2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   S01 family glutamyl endopeptidase
tr|Q2FI29 Staphylococcus aureus (strain USA300) TrEMBL   V8 protease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3306605);gjo
evidence_code dlit(96922);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search