The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.992: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
Translate Function Assignments



Context on contig NC_009641 from base 1011043 to 1024636 (13594 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
987 1011043 1012716 1674 +       2: 1 2   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|memD, locus|NWMN_0913, protein_id|YP_001331947.1, gi|151221125, geneID|5330552
988 1012703 1013506 804 + -14     2: 1 2   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8     2: 1 2 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 4 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 7 5   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 8 6 3   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
EC_3.4.21.-_Serine_endopeptidase gjo Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA


  Protein Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKP
LEQREHANVILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV
VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVV
KPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSP
VFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNPNN
PDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA

MD5 = d27b8bab4626acd15d52733c1796379b


  DNA Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
atgaaaggtaaatttttaaaagttagttctttattcgttgcaactttgacaacagcgaca
cttgtgagttctccagcagcaaacgcgttatcttcaaaggctatggacaatcatccacaa
caaacgcagtcaagcaaacagcaaacacctaagattcaaaaaggcggtaaccttaaacca
ttagaacaacgtgaacacgcaaatgttatattaccaaataacgatcgtcaccaaatcaca
gatacaacgaatggtcattatgcacccgtaacttatattcaagttgaagcacctactggt
acatttattgcttccggtgtagttgtaggtaaagatactcttttaacaaataaacacgtc
gtagatgctacgcacggtgatcctcatgctttaaaagcattcccttctgcaattaaccaa
gacaattatccaaatggtggtttcactgctgaacaaatcactaaatattcaggcgaaggt
gatttagcaatagttaaattctcccctaatgagcaaaacaaacatattggtgaagtagtt
aaaccagcaacaatgagtaataatgctgaaacacaagttaaccaaaatattactgtaaca
ggatatcctggtgataaacctgtagcaacaatgtgggaaagtaaaggaaaaatcacttac
ctcaaaggcgaagctatgcaatatgatttaagtacaactggtggtaattcaggttcacct
gtatttaatgaaaaaaatgaagtgatcggaattcattggggcggtgtaccaaatgaattt
aatggtgcggtatttattaatgaaaatgtacgcaacttcttaaaacaaaatattgaagat
atccattttgccaacgatgaccaacctaataacccagataatcctgataaccctaacaat
cctgataaccctaacaacccagatgaaccaaataaccctgacaaccctaacaaccctgat
aatccagacaatggcgataacaataattcagacaatccagatgcagcttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.992 Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
aactaaattcatagtacgttcagttttttatattctataagttttaaataatactctata
gagactgtaaatactaccgagttatattcctctcctttaaacacctcactcaaaatgatt
ctatcaaaaggttttaatatgctaacttataattgttcttcgaaacttaagcactcaaat
aatatatcaccattcatattaatctacctttggccaaacaattattattcaaaagttact
atttattattataaacaaatactttccattcgctctcaattcctttcttatttattcttt
tagataaatgcaaacaattgacgatcttatcaatttaactcaattgaataaagtataata
caattcaattttaattcccttaatgtttttgtaaactctaatctttacaaaaacttttta
atttatttatatattcttattgacttaaaaatttttagtgttatatttaacttgtaaata
aattttttggaggtttttagatgaaaggtaaatttttaaaagttagttctttattcgttg
caactttgacaacagcgacacttgtgagttctccagcagcaaacgcgttatcttcaaagg
ctatggacaatcatccacaacaaacgcagtcaagcaaacagcaaacacctaagattcaaa
aaggcggtaaccttaaaccattagaacaacgtgaacacgcaaatgttatattaccaaata
acgatcgtcaccaaatcacagatacaacgaatggtcattatgcacccgtaacttatattc
aagttgaagcacctactggtacatttattgcttccggtgtagttgtaggtaaagatactc
ttttaacaaataaacacgtcgtagatgctacgcacggtgatcctcatgctttaaaagcat
tcccttctgcaattaaccaagacaattatccaaatggtggtttcactgctgaacaaatca
ctaaatattcaggcgaaggtgatttagcaatagttaaattctcccctaatgagcaaaaca
aacatattggtgaagtagttaaaccagcaacaatgagtaataatgctgaaacacaagtta
accaaaatattactgtaacaggatatcctggtgataaacctgtagcaacaatgtgggaaa
gtaaaggaaaaatcacttacctcaaaggcgaagctatgcaatatgatttaagtacaactg
gtggtaattcaggttcacctgtatttaatgaaaaaaatgaagtgatcggaattcattggg
gcggtgtaccaaatgaatttaatggtgcggtatttattaatgaaaatgtacgcaacttct
taaaacaaaatattgaagatatccattttgccaacgatgaccaacctaataacccagata
atcctgataaccctaacaatcctgataaccctaacaacccagatgaaccaaataaccctg
acaaccctaacaaccctgataatccagacaatggcgataacaataattcagacaatccag
atgcagcttaattaacaattaagttcgtctagataaaatagaagcaaagtcttagcaacg
taaaatattttgatttaaatggagggtattatatgaatagttcatgtaaatctagagtat
tcaatattataagcatcataatggtttcaatgcttattttatcactaggcgcatttgcta
ataacaataaagccaaagccgattcacactctaaacagctagaaattaatgttaagagtg
acaaagtacctcaaaaagtaaaagatctagcacaacaacaatttgctggttatgctaaag
cattagataaacaaagtaatgcaaaaactggtaaatatgaacttggcgaagcttttaaaa
tttataaatttaatggtgaagaagataatagttactattatccagttataaaagacggta
aaattgtttatactttaacacttagtcctaaaaataaagatgatttaaacaaatcaaaag
aagacatgaattacagtgttaaaatttcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004252       F:serine-type endopeptidase activity
GO:0005576       C:extracellular region
GO:0006508       P:proteolysis
GO:0009405       P:pathogenesis
cmr|NT05SA0896 Staphylococcus aureus NCTC 8325     glutamyl endopeptidase
cmr|SAUSA300_0951 Staphylococcus aureus subsp. aureus USA300-FPR3757     V8 protease
dbj|BAF67190.1 Staphylococcus aureus subsp. aureus str. Newman     V8 protease, glutamyl endopeptidase precursor
emb|CAA68434.1 Staphylococcus aureus EMBL   unnamed protein product
fig|367830.3.peg.1516 Staphylococcus aureus subsp. aureus USA300 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|426430.6.peg.887 Staphylococcus aureus subsp. aureus str. Newman FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|451515.3.peg.1044 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|451516.9.peg.1048 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|546342.3.peg.1018 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|546343.3.peg.1885 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553567.3.peg.1501 Staphylococcus aureus A5948 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553590.4.peg.92 Staphylococcus aureus A9754 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|553594.3.peg.2031 Staphylococcus aureus A9765 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|644279.4.peg.1053 Staphylococcus aureus subsp. aureus 132 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|93061.3.peg.950 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
fig|93061.5.peg.908 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA
gb|AAG45843.1 Staphylococcus aureus     SspA
gb|ABD21260.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     V8 protease
gb|ABD30113.1 Staphylococcus aureus subsp. aureus NCTC 8325     glutamyl endopeptidase precursor, putative
gb|ABX29016.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     S01 family glutamyl endopeptidase
gb|AF309515_1 Staphylococcus aureus     SspA
gb|EEV83049.1 Staphylococcus aureus A5948     serine protease
gi|114152162 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
gi|114152163 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
gi|12025238 Staphylococcus aureus NCBI   SspA
gi|150373930 Staphylococcus aureus subsp. aureus str. Newman NCBI   V8 protease, glutamyl endopeptidase precursor
gi|151221130 Staphylococcus aureus subsp. aureus str. Newman NCBI   V8 protease, glutamyl endopeptidase precursor
gi|160368045 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   S01 family glutamyl endopeptidase
gi|161509236 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glutamyl endopeptidase
gi|221138026 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glutamyl endopeptidase precursor
gi|221141832 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glutamyl endopeptidase precursor
gi|257860217 Staphylococcus aureus A5948 NCBI   serine protease
gi|258452002 Staphylococcus aureus A5948 NCBI   serine protease
gi|46687 Staphylococcus aureus NCBI   unnamed protein product
gi|87126746 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   V8 protease
gi|87160772 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   V8 protease
gi|87202303 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamyl endopeptidase precursor, putative
gi|88194745 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamyl endopeptidase precursor, putative
img|637887603 Staphylococcus aureus aureus USA300 IMG   V8 protease( EC:3.4.21.19 )
img|637893634 Staphylococcus aureus aureus NCTC 8325 IMG   glutamyl endopeptidase precursor, putative
img|640795298 Staphylococcus aureus aureus Newman IMG   V8 protease, glutamyl endopeptidase precursor
img|641308966 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   S01 family glutamyl endopeptidase( EC:3.4.21.19 )
img|641772570 Staphylococcus aureus aureus USA300_TCH959 IMG   S01 family glutamyl endopeptidase
kegg|saa:SAUSA300_0951 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   V8 protease (EC:3.4.21.19)
kegg|sae:NWMN_0918 Staphylococcus aureus subsp. aureus Newman KEGG   V8 protease, glutamyl endopeptidase precursor
kegg|sao:SAOUHSC_00988 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   glutamyl endopeptidase precursor, putative
kegg|sax:USA300HOU_0996 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glutamyl endopeptidase (EC:3.4.21.19)
ref|YP_001331952.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   V8 protease, glutamyl endopeptidase precursor
ref|YP_001574895.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glutamyl endopeptidase
ref|YP_493649.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   V8 protease
ref|YP_499541.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   glutamyl endopeptidase precursor, putative
ref|ZP_03562828.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glutamyl endopeptidase precursor
ref|ZP_03566325.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glutamyl endopeptidase precursor
ref|ZP_05700018.1 Staphylococcus aureus A5948 RefSeq   serine protease
sp|P0C1U8 Staphylococcus aureus SwissProt   Glutamyl endopeptidase precursor
sp|Q2FZL2 Staphylococcus aureus (strain NCTC 8325) SwissProt   Glutamyl endopeptidase precursor
sp|SSPA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
sp|SSPA_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glutamyl endopeptidase; AltName: Full=Staphylococcal serine proteinase; AltName: Full=V8 protease; AltName: Full=V8 proteinase; AltName: Full=Endoproteinase Glu-C; Flags: Precursor
tr|A6QFQ8 Staphylococcus aureus (strain Newman) TrEMBL   V8 protease, glutamyl endopeptidase
tr|A8Z0E2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   S01 family glutamyl endopeptidase
tr|Q2FI29 Staphylococcus aureus (strain USA300) TrEMBL   V8 protease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3306605);gjo
evidence_code dlit(96922);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search