The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.991: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Staphopain B precursor (EC 3.4.22.-)
Translate Function Assignments



Context on contig NC_009641 from base 1009845 to 1024636 (14792 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
986 1009845 1011056 1212 +       2: 2 1   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|NWMN_0912, protein_id|YP_001331946.1, gi|151221124, geneID|5330551
987 1011043 1012716 1674 + -14     2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|memD, locus|NWMN_0913, protein_id|YP_001331947.1, gi|151221125, geneID|5330552
988 1012703 1013506 804 + -14     2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8     2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 7 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 5 8   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 6 4 3   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.991 Staphopain B precursor (EC 3.4.22.-)
MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLA
QQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPK
NKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATP
LPGNVKEKESAKTVSAKLKQELKNTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDN
SWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDI
HYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWN
PWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

MD5 = 9ed1af4614294df17eeb5fd71b2ac6b9


  DNA Sequence

>fig|426430.8.peg.991 Staphopain B precursor (EC 3.4.22.-)
atgaatagttcatgtaaatctagagtattcaatattataagcatcataatggtttcaatg
cttattttatcactaggcgcatttgctaataacaataaagccaaagccgattcacactct
aaacagctagaaattaatgttaagagtgacaaagtacctcaaaaagtaaaagatctagca
caacaacaatttgctggttatgctaaagcattagataaacaaagtaatgcaaaaactggt
aaatatgaacttggcgaagcttttaaaatttataaatttaatggtgaagaagataatagt
tactattatccagttataaaagacggtaaaattgtttatactttaacacttagtcctaaa
aataaagatgatttaaacaaatcaaaagaagacatgaattacagtgttaaaatttcaaac
ttcatcgctaaagatttagaccaaattaaagataaaaattcaaatatcactgttcttact
gatgaaaaagggttttattttgaagaagatggcaaagttagattagtaaaagctacgcct
ctacctggtaatgtaaaagaaaaagaaagtgctaaaacagtttcagcaaaattgaaacaa
gagttaaaaaatacagtaacacctactaaagttgaagaaaacgaagcgatacaagaagat
caagttcaatatgaaaatacattaaaaaacttcaaaattagagaacaacaattcgataac
tcatggtgtgcaggattcagtatggcagcattattaaatgcaactaaaaatacagacact
tataatgcacatgatattatgcgtacattataccctgaagtaagtgagcaagaccttcct
aattgtgcaacattccctaatcaaatgattgaatacggtaaatcacaaggcagagatatt
cattatcaagaaggcgtaccatcatatgaacaagttgatcaacttacaaaagataatgta
ggaattatgatccttgcacaaagtgtatctcaaaaccctaatgacccacatttaggacat
gcgctagcagttgttggtaatgctaaaattaatgaccaagaaaaacttatttactggaat
ccttgggatacagaattatcaatccaagatgcagattcaagcctattacatttatcattc
aatcgtgattataactggtatggttcaatgataggttactaa


  DNA with Flanking Sequence

>fig|426430.8.peg.991 Staphopain B precursor (EC 3.4.22.-)
ctgtaacaggatatcctggtgataaacctgtagcaacaatgtgggaaagtaaaggaaaaa
tcacttacctcaaaggcgaagctatgcaatatgatttaagtacaactggtggtaattcag
gttcacctgtatttaatgaaaaaaatgaagtgatcggaattcattggggcggtgtaccaa
atgaatttaatggtgcggtatttattaatgaaaatgtacgcaacttcttaaaacaaaata
ttgaagatatccattttgccaacgatgaccaacctaataacccagataatcctgataacc
ctaacaatcctgataaccctaacaacccagatgaaccaaataaccctgacaaccctaaca
accctgataatccagacaatggcgataacaataattcagacaatccagatgcagcttaat
taacaattaagttcgtctagataaaatagaagcaaagtcttagcaacgtaaaatattttg
atttaaatggagggtattatatgaatagttcatgtaaatctagagtattcaatattataa
gcatcataatggtttcaatgcttattttatcactaggcgcatttgctaataacaataaag
ccaaagccgattcacactctaaacagctagaaattaatgttaagagtgacaaagtacctc
aaaaagtaaaagatctagcacaacaacaatttgctggttatgctaaagcattagataaac
aaagtaatgcaaaaactggtaaatatgaacttggcgaagcttttaaaatttataaattta
atggtgaagaagataatagttactattatccagttataaaagacggtaaaattgtttata
ctttaacacttagtcctaaaaataaagatgatttaaacaaatcaaaagaagacatgaatt
acagtgttaaaatttcaaacttcatcgctaaagatttagaccaaattaaagataaaaatt
caaatatcactgttcttactgatgaaaaagggttttattttgaagaagatggcaaagtta
gattagtaaaagctacgcctctacctggtaatgtaaaagaaaaagaaagtgctaaaacag
tttcagcaaaattgaaacaagagttaaaaaatacagtaacacctactaaagttgaagaaa
acgaagcgatacaagaagatcaagttcaatatgaaaatacattaaaaaacttcaaaatta
gagaacaacaattcgataactcatggtgtgcaggattcagtatggcagcattattaaatg
caactaaaaatacagacacttataatgcacatgatattatgcgtacattataccctgaag
taagtgagcaagaccttcctaattgtgcaacattccctaatcaaatgattgaatacggta
aatcacaaggcagagatattcattatcaagaaggcgtaccatcatatgaacaagttgatc
aacttacaaaagataatgtaggaattatgatccttgcacaaagtgtatctcaaaacccta
atgacccacatttaggacatgcgctagcagttgttggtaatgctaaaattaatgaccaag
aaaaacttatttactggaatccttgggatacagaattatcaatccaagatgcagattcaa
gcctattacatttatcattcaatcgtgattataactggtatggttcaatgataggttact
aaaaagtaatatagatattgattaaaggcaggtaaaactatgtatcaactacaatttata
aatttagtttacgacacaaccaaactcacacatctagaacaaaccaatatcaatttattc
attggtaattggagtaatcatcaattacaaaaatcaatttgtatacgtcatggcgatgat
acaagtcacaatcaatatcatattctttttatagatacggcacatcaacgcattaaattt
tcatctattgataatgaagaaatcatttatattcttgattatgatgatacacagcatatc
ctcatgcaaacgtcatccaaacaaggtattggcacttcgcgaccaatcgtttatgagcgc
ttagtataactaatttaaatgatttcacttcataaagcgggttggcgagaattcaatttc
tcaccagctcgttttttcattgtaataataatctttaacatttattctttctctattaat
ttttctcaaactatcttatctt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004197       F:cysteine-type endopeptidase activity
GO:0005576       C:extracellular region
GO:0006508       P:proteolysis
GO:0009405       P:pathogenesis
cmr|NT05SA0895 Staphylococcus aureus NCTC 8325     staphopain B
cmr|SACOL1056 Staphylococcus aureus subsp. aureus COL     cysteine protease precursor SspB
cmr|SAUSA300_0950 Staphylococcus aureus subsp. aureus USA300-FPR3757     cysteine protease precursor
dbj|BAF67189.1 Staphylococcus aureus subsp. aureus str. Newman     cysteine protease precursor
fig|367830.3.peg.1515 Staphylococcus aureus subsp. aureus USA300 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|426430.6.peg.886 Staphylococcus aureus subsp. aureus str. Newman FIG   Staphopain B precursor (EC 3.4.22.-)
fig|451515.3.peg.1043 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|451516.9.peg.1047 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|452948.4.peg.2059 Staphylococcus aureus 930918-3 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|553567.3.peg.1502 Staphylococcus aureus A5948 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|553590.4.peg.91 Staphylococcus aureus A9754 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|553594.3.peg.2030 Staphylococcus aureus A9765 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|644279.4.peg.1052 Staphylococcus aureus subsp. aureus 132 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|93061.3.peg.949 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|93061.5.peg.907 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Staphopain B precursor (EC 3.4.22.-)
fig|93062.4.peg.1225 Staphylococcus aureus subsp. aureus COL FIG   Staphopain B precursor (EC 3.4.22.-)
gb|AAG45844.1 Staphylococcus aureus     cysteine protease precursor
gb|AAW36521.1 Staphylococcus aureus subsp. aureus COL     cysteine protease precursor SspB
gb|ABD21828.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     cysteine protease precursor
gb|ABD30112.1 Staphylococcus aureus subsp. aureus NCTC 8325     cysteine protease precursor, putative
gb|ABX29015.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     C47 family staphopain B
gb|AF309515_2 Staphylococcus aureus     cysteine protease precursor
gb|EEV83050.1 Staphylococcus aureus A5948     staphopain B
gi|112824002 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
gi|12025239 Staphylococcus aureus NCBI   cysteine protease precursor
gi|150373929 Staphylococcus aureus subsp. aureus str. Newman NCBI   cysteine protease precursor
gi|151221129 Staphylococcus aureus subsp. aureus str. Newman NCBI   cysteine protease precursor
gi|160368044 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   C47 family staphopain B
gi|161509235 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   C47 family staphopain B
gi|257860218 Staphylococcus aureus A5948 NCBI   staphopain B
gi|258452003 Staphylococcus aureus A5948 NCBI   staphopain B
gi|57284427 Staphylococcus aureus subsp. aureus COL NCBI   cysteine protease precursor SspB
gi|57650241 Staphylococcus aureus subsp. aureus COL NCBI   cysteine protease precursor SspB
gi|68566024 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
gi|87127314 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cysteine protease precursor
gi|87161340 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cysteine protease precursor
gi|87202302 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cysteine protease precursor, putative
gi|88194744 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cysteine protease precursor, putative
img|637151820 Staphylococcus aureus aureus COL IMG   cysteine protease precursor SspB
img|637887602 Staphylococcus aureus aureus USA300 IMG   cysteine protease precursor( EC:3.4.22.48 )
img|637893633 Staphylococcus aureus aureus NCTC 8325 IMG   cysteine protease precursor, putative
img|640795297 Staphylococcus aureus aureus Newman IMG   cysteine protease precursor
img|641308965 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   C47 family staphopain B
img|641772569 Staphylococcus aureus aureus USA300_TCH959 IMG   C47 family staphopain B
kegg|saa:SAUSA300_0950 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   cysteine protease precursor (EC:3.4.22.48)
kegg|sac:SACOL1056 Staphylococcus aureus subsp. aureus COL KEGG   cysteine protease precursor SspB
kegg|sae:NWMN_0917 Staphylococcus aureus subsp. aureus Newman KEGG   cysteine protease precursor
kegg|sao:SAOUHSC_00987 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   cysteine protease precursor, putative
kegg|sax:USA300HOU_0995 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   C47 family staphopain B
ref|YP_001331951.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   cysteine protease precursor
ref|YP_001574894.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   C47 family staphopain B
ref|YP_185921.1 Staphylococcus aureus subsp. aureus COL RefSeq   cysteine protease precursor SspB
ref|YP_493648.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   cysteine protease precursor
ref|YP_499540.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   cysteine protease precursor, putative
ref|ZP_05700019.1 Staphylococcus aureus A5948 RefSeq   staphopain B
sp|Q2FZL3 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
sp|Q5HH36 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
sp|SSPB_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
sp|SSPB_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphopain B; AltName: Full=Staphylopain B; AltName: Full=Staphylococcal cysteine proteinase B; Flags: Precursor
tr|A6QFQ7 Staphylococcus aureus (strain Newman) TrEMBL   Cysteine protease
tr|A8Z0E1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   C47 family staphopain B
tr|Q2FI30 Staphylococcus aureus (strain USA300) TrEMBL   Cysteine protease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search