The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.990: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Staphostatin B
Translate Function Assignments



Context on contig NC_009641 from base 1009845 to 1020087 (10243 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
986 1009845 1011056 1212 +       2: 2 1   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|NWMN_0912, protein_id|YP_001331946.1, gi|151221124, geneID|5330551
987 1011043 1012716 1674 + -14     2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|memD, locus|NWMN_0913, protein_id|YP_001331947.1, gi|151221125, geneID|5330552
988 1012703 1013506 804 + -14     2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8     2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 4 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 3 5   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.990 Staphostatin B
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV

MD5 = 5a7c5da92e7604b1826263405df8af89


  DNA Sequence

>fig|426430.8.peg.990 Staphostatin B
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa


  DNA with Flanking Sequence

>fig|426430.8.peg.990 Staphostatin B
ctcatggtgtgcaggattcagtatggcagcattattaaatgcaactaaaaatacagacac
ttataatgcacatgatattatgcgtacattataccctgaagtaagtgagcaagaccttcc
taattgtgcaacattccctaatcaaatgattgaatacggtaaatcacaaggcagagatat
tcattatcaagaaggcgtaccatcatatgaacaagttgatcaacttacaaaagataatgt
aggaattatgatccttgcacaaagtgtatctcaaaaccctaatgacccacatttaggaca
tgcgctagcagttgttggtaatgctaaaattaatgaccaagaaaaacttatttactggaa
tccttgggatacagaattatcaatccaagatgcagattcaagcctattacatttatcatt
caatcgtgattataactggtatggttcaatgataggttactaaaaagtaatatagatatt
gattaaaggcaggtaaaactatgtatcaactacaatttataaatttagtttacgacacaa
ccaaactcacacatctagaacaaaccaatatcaatttattcattggtaattggagtaatc
atcaattacaaaaatcaatttgtatacgtcatggcgatgatacaagtcacaatcaatatc
atattctttttatagatacggcacatcaacgcattaaattttcatctattgataatgaag
aaatcatttatattcttgattatgatgatacacagcatatcctcatgcaaacgtcatcca
aacaaggtattggcacttcgcgaccaatcgtttatgagcgcttagtataactaatttaaa
tgatttcacttcataaagcgggttggcgagaattcaatttctcaccagctcgttttttca
ttgtaataataatctttaacatttattctttctctattaatttttctcaaactatcttat
ctttatgataattaattaaaatgcccttttaaattcttataaaataaaaaagccacctat
cgtcgctaataaacgacgcaagtgacttaatatcatattcaaaataacttatgggaattt
agggaattgatcgaagtcaggatcacgtttttctttaaacgcatcacggccttctttcgc
ttcatcagttgtgtaataaagcaatgttgcatccccagccatttgttgtaaaccagctaa
accatctgtgtcagcattcatagctgctttaaggaatcgtaacgctgttggtgagtgttt
cataatctctttacaccattgcacagtttcatcttcaactttctctaaaggtaccactgt
atttactaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004869       F:cysteine protease inhibitor activity
GO:0005737       C:cytoplasm
GO:0008233       F:peptidase activity
GO:0009405       P:pathogenesis
cmr|NT03SA1014 Staphylococcus aureus MW2     cysteine protease
cmr|NT05SA0894 Staphylococcus aureus NCTC 8325     staphostatin B
cmr|NT09SA0978 Staphylococcus aureus subsp. aureus MSSA476     cysteine protieinase
cmr|NT11SA0928 Staphylococcus aureus RF122     staphostatin B
cmr|SACOL1055 Staphylococcus aureus subsp. aureus COL     sspC protein
cmr|SAUSA300_0949 Staphylococcus aureus subsp. aureus USA300-FPR3757     cysteine protease
dbj|BAB94795.1 Staphylococcus aureus subsp. aureus MW2     cysteine protease
dbj|BAF67188.1 Staphylococcus aureus subsp. aureus str. Newman     cysteine protease precursor
emb|CAG42757.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
emb|CAI80601.1 Staphylococcus aureus RF122 EMBL   cysteine protease
fig|196620.1.peg.930 Staphylococcus aureus subsp. aureus MW2 FIG   Staphostatin B
fig|196620.5.peg.975 Staphylococcus aureus subsp. aureus MW2 FIG   Staphostatin B
fig|273036.3.peg.1032 Staphylococcus aureus RF122 FIG   Staphostatin B
fig|273036.6.peg.973 Staphylococcus aureus RF122 FIG   Staphostatin B
fig|282459.1.peg.974 Staphylococcus aureus subsp. aureus MSSA476 FIG   Staphostatin B
fig|282459.5.peg.1017 Staphylococcus aureus subsp. aureus MSSA476 FIG   Staphostatin B
fig|367830.3.peg.1514 Staphylococcus aureus subsp. aureus USA300 FIG   Staphostatin B
fig|450394.6.peg.239 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Staphostatin B
fig|451515.3.peg.1042 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Staphostatin B
fig|451516.9.peg.1046 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Staphostatin B
fig|452948.4.peg.2058 Staphylococcus aureus 930918-3 FIG   Staphostatin B
fig|455227.3.peg.1406 Staphylococcus aureus D30 FIG   Staphostatin B
fig|546342.3.peg.1016 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Staphostatin B
fig|546343.3.peg.1883 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Staphostatin B
fig|548474.3.peg.1270 Staphylococcus aureus subsp. aureus TCH130 FIG   Staphostatin B
fig|548475.3.peg.1277 Staphylococcus aureus subsp. aureus TCH70 FIG   Staphostatin B
fig|553567.3.peg.1503 Staphylococcus aureus A5948 FIG   Staphostatin B
fig|553583.3.peg.1064 Staphylococcus aureus A9635 FIG   Staphostatin B
fig|553590.4.peg.90 Staphylococcus aureus A9754 FIG   Staphostatin B
fig|553594.3.peg.2029 Staphylococcus aureus A9765 FIG   Staphostatin B
fig|585152.3.peg.894 Staphylococcus aureus subsp. aureus D139 FIG   Staphostatin B
fig|585155.3.peg.2317 Staphylococcus aureus subsp. aureus H19 FIG   Staphostatin B
fig|644279.4.peg.1051 Staphylococcus aureus subsp. aureus 132 FIG   Staphostatin B
fig|762962.3.peg.1022 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Staphostatin B
fig|93061.3.peg.948 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Staphostatin B
fig|93061.5.peg.906 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Staphostatin B
fig|93062.19.peg.1026 Staphylococcus aureus subsp. aureus COL FIG   Staphostatin B
fig|93062.4.peg.1224 Staphylococcus aureus subsp. aureus COL FIG   Staphostatin B
gb|AAG45845.1 Staphylococcus aureus     SspC
gb|AAW36520.1 Staphylococcus aureus subsp. aureus COL     sspC protein
gb|ABD20764.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     cysteine protease
gb|ABD30111.1 Staphylococcus aureus subsp. aureus NCTC 8325     cysteine protease, putative
gb|ABX29014.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     I57 family staphostatin B
gb|AF309515_3 Staphylococcus aureus     SspC
gb|EES55291.1 Staphylococcus aureus subsp. aureus TCH70     I57 family staphostatin B
gb|EES93381.1 Staphylococcus aureus subsp. aureus USA300_TCH959     I57 family staphostatin B
gb|EES98100.1 Staphylococcus aureus subsp. aureus TCH130     I57 family staphostatin B
gb|EEV70273.1 Staphylococcus aureus A9635     staphostatin B
gb|EEV83051.1 Staphylococcus aureus A5948     staphostatin B
gb|EEW44334.1 Staphylococcus aureus 930918-3     cysteine protease
gb|EEW47067.1 Staphylococcus aureus D30     cysteine protease
gi|12025240 Staphylococcus aureus NCBI   SspC
gi|150373928 Staphylococcus aureus subsp. aureus str. Newman NCBI   cysteine protease precursor
gi|151221128 Staphylococcus aureus subsp. aureus str. Newman NCBI   cysteine protease precursor
gi|160368043 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   I57 family staphostatin B
gi|161509234 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   I57 family staphostatin B
gi|21204097 Staphylococcus aureus subsp. aureus MW2 NCBI   cysteine protease
gi|21282659 Staphylococcus aureus subsp. aureus MW2 NCBI   cysteine protease
gi|221138024 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   I57 family staphostatin B
gi|221141830 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   I57 family staphostatin B
gi|251802634 Staphylococcus aureus subsp. aureus TCH70 NCBI   I57 family staphostatin B
gi|251813944 Staphylococcus aureus subsp. aureus TCH70 NCBI   I57 family staphostatin B
gi|253724652 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   I57 family staphostatin B
gi|253729371 Staphylococcus aureus subsp. aureus TCH130 NCBI   I57 family staphostatin B
gi|253731653 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   I57 family staphostatin B
gi|253732593 Staphylococcus aureus subsp. aureus TCH130 NCBI   I57 family staphostatin B
gi|257846249 Staphylococcus aureus A9635 NCBI   staphostatin B
gi|257860219 Staphylococcus aureus A5948 NCBI   staphostatin B
gi|258423548 Staphylococcus aureus A9635 NCBI   staphostatin B
gi|258452004 Staphylococcus aureus A5948 NCBI   staphostatin B
gi|259159276 Staphylococcus aureus 930918-3 NCBI   cysteine protease
gi|259162498 Staphylococcus aureus D30 NCBI   cysteine protease
gi|49244329 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49485886 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0982
gi|57284426 Staphylococcus aureus subsp. aureus COL NCBI   sspC protein
gi|57650240 Staphylococcus aureus subsp. aureus COL NCBI   sspC protein
gi|73621951 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
gi|73621955 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
gi|73621956 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
gi|73621957 organism not parsed/found in ncbi nr NCBI   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
gi|82656189 Staphylococcus aureus RF122 NCBI   cysteine protease
gi|82750658 Staphylococcus aureus RF122 NCBI   cysteine protease
gi|87126250 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cysteine protease
gi|87160276 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cysteine protease
gi|87202301 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cysteine protease, putative
gi|88194743 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cysteine protease, putative
img|637151819 Staphylococcus aureus aureus COL IMG   sspC protein
img|637157210 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298693 Staphylococcus aureus aureus MW2 IMG   cysteine protease
img|637815869 Staphylococcus aureus RF122 IMG   cysteine protease
img|637887601 Staphylococcus aureus aureus USA300 IMG   cysteine protease
img|637893632 Staphylococcus aureus aureus NCTC 8325 IMG   cysteine protease, putative
img|640795296 Staphylococcus aureus aureus Newman IMG   cysteine protease precursor
img|641308964 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   I57 family staphostatin B
img|641772568 Staphylococcus aureus aureus USA300_TCH959 IMG   I57 family staphostatin B
kegg|saa:SAUSA300_0949 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   cysteine protease
kegg|sab:SAB0913c Staphylococcus aureus RF122 KEGG   cysteine protease
kegg|sac:SACOL1055 Staphylococcus aureus subsp. aureus COL KEGG   SspC protein
kegg|sae:NWMN_0916 Staphylococcus aureus subsp. aureus Newman KEGG   cysteine protease precursor
kegg|sam:MW0930 Staphylococcus aureus subsp. aureus MW2 KEGG   cysteine protease
kegg|sao:SAOUHSC_00986 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   cysteine protease, putative
kegg|sas:SAS0982   KEGG   hypothetical protein
kegg|sax:USA300HOU_0994 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   I57 family staphostatin B
ref|NP_645747.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   cysteine protease
ref|YP_001331950.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   cysteine protease precursor
ref|YP_001574893.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   I57 family staphostatin B
ref|YP_043107.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0982
ref|YP_185920.1 Staphylococcus aureus subsp. aureus COL RefSeq   sspC protein
ref|YP_416399.1 Staphylococcus aureus RF122 RefSeq   cysteine protease
ref|YP_493647.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   cysteine protease
ref|YP_499539.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   cysteine protease, putative
ref|ZP_03562826.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   I57 family staphostatin B
ref|ZP_03566323.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   I57 family staphostatin B
ref|ZP_04828417.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   I57 family staphostatin B
ref|ZP_04865818.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   I57 family staphostatin B
ref|ZP_04866758.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   I57 family staphostatin B
ref|ZP_05686438.1 Staphylococcus aureus A9635 RefSeq   staphostatin B
ref|ZP_05700020.1 Staphylococcus aureus A5948 RefSeq   staphostatin B
sp|Q5HH37 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|Q6GAG6 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|Q7A189 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|Q9EYW6 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|SSPC_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|SSPC_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|SSPC_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
sp|SSPC_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Staphostatin B; AltName: Full=Staphylococcal cysteine protease B inhibitor
tr|A6QFQ6 Staphylococcus aureus (strain Newman) TrEMBL   Cysteine protease
tr|A8Z0E0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   I57 family staphostatin B
tr|C5N4C6 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   I57 family staphostatin B
tr|C5PXZ8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   I57 family staphostatin B
tr|C5QI01 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   I57 family staphostatin B
tr|Q2FI31 Staphylococcus aureus (strain USA300) TrEMBL   Cysteine protease
tr|Q2YX27 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Cysteine protease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search