The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.989: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Naphthoate synthase (EC 4.1.3.36)
Translate Function Assignments



Context on contig NC_009641 from base 1007972 to 1020087 (12116 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
984 1007972 1008523 552 +           Acetyltransferase (GNAT family) SAS0976 locus|NWMN_0910, protein_id|YP_001331944.1, gi|151221122, geneID|5330549
985 1009513 1008575 939 - 51 5 2: 1 2   1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) locus|NWMN_0911, protein_id|YP_001331945.1, gi|151221123, geneID|5330550
986 1009845 1011056 1212 + 331 4 2: 1 2   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|NWMN_0912, protein_id|YP_001331946.1, gi|151221124, geneID|5330551
987 1011043 1012716 1674 + -14 25 2: 1 2   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) gene_name|memD, locus|NWMN_0913, protein_id|YP_001331947.1, gi|151221125, geneID|5330552
988 1012703 1013506 804 + -14 6 2: 1 2   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|NWMN_0914, protein_id|YP_001331948.1, gi|151221126, geneID|5332122
989 1013499 1014320 822 + -8   2: 1 2 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 3 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 5 4   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Menaquinone_and_Phylloquinone_Biosynthesis OlgaZ Naphthoate synthase (EC 4.1.3.36)
Menaquinone_biosynthesis_PanGenomes Smajic_Semra_user Naphthoate synthase (EC 4.1.3.36)


  Protein Sequence

>fig|426430.8.peg.989 Naphthoate synthase (EC 4.1.3.36)
MTNRQWETLREYDEIKYEFYEGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSV
IVLTGEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMVKGYAVG
GGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNA
QEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGD
ATLLYYTTDEAKEGRDAFKEKRDPDFDQFPKFP

MD5 = 4bedf00869d8ddb9199e7ac74be6ad1c


  DNA Sequence

>fig|426430.8.peg.989 Naphthoate synthase (EC 4.1.3.36)
atgactaacagacaatgggaaacacttagagaatatgatgaaatcaaatatgaattttac
gaagggattgctaaggtaacaataaatcgccctgaagtacgcaatgcgtttacacctaaa
acagttgctgaaatgattgacgcattttcacgtgcacgtgatgatcaaaacgtttcagtt
atcgtattaactggtgaaggtgatttagcattctgttctggtggtgaccagaagaaacgt
ggacatggtggttatgtaggtgaagaccaaatccctcgcttaaatgtattagatttacag
cgtttaattcgtattattccaaaaccggttatcgcgatggtaaaaggttatgctgtaggt
ggcggtaatgtactaaatgttgtttgtgacttaacgattgctgctgataatgctattttt
ggacaaactggtcctaaagtaggttcatttgatgcgggttatggttcaggatatttagca
cgtatcgttggacataagaaagcacgtgaaatttggtacttatgtcgtcaatacaatgca
caagaagctttagatatgggtctagtaaatacagtggtacctttagagaaagttgaagat
gaaactgtgcaatggtgtaaagagattatgaaacactcaccaacagcgttacgattcctt
aaagcagctatgaatgctgacacagatggtttagctggtttacaacaaatggctggggat
gcaacattgctttattacacaactgatgaagcgaaagaaggccgtgatgcgtttaaagaa
aaacgtgatcctgacttcgatcaattccctaaattcccataa


  DNA with Flanking Sequence

>fig|426430.8.peg.989 Naphthoate synthase (EC 4.1.3.36)
aattaatggtcacatccctatatctaatttgatattagaaagtacgtcaccaggtattaa
agaagaagcaaatcaattggaacgccgtcttgttgatgatgcacgtgctaaagtattaga
catagcaggtattgaattatttgttaatgattgggaaaagttgccattatttcaatcgca
actagaattaccagttgaaatacaacatcaaataagacaacaacgattgtctcaatcgcc
acataaaatggccaaagcattaagagattatggtacaggtcaaatgccaaacttatggcc
gcgcctgaaagaaattaaagtaccaacattaatattagctggagaatatgatgaaaaatt
tgtacagattgcgaaaaaaatggcaaatttaattcctaatagtaaatgtaaattaatttc
tgctacaggtcatacaattcatgtggaagatagtgatgaatttgatacaatgatattagg
atttttaaaggaggagcaaaatgactaacagacaatgggaaacacttagagaatatgatg
aaatcaaatatgaattttacgaagggattgctaaggtaacaataaatcgccctgaagtac
gcaatgcgtttacacctaaaacagttgctgaaatgattgacgcattttcacgtgcacgtg
atgatcaaaacgtttcagttatcgtattaactggtgaaggtgatttagcattctgttctg
gtggtgaccagaagaaacgtggacatggtggttatgtaggtgaagaccaaatccctcgct
taaatgtattagatttacagcgtttaattcgtattattccaaaaccggttatcgcgatgg
taaaaggttatgctgtaggtggcggtaatgtactaaatgttgtttgtgacttaacgattg
ctgctgataatgctatttttggacaaactggtcctaaagtaggttcatttgatgcgggtt
atggttcaggatatttagcacgtatcgttggacataagaaagcacgtgaaatttggtact
tatgtcgtcaatacaatgcacaagaagctttagatatgggtctagtaaatacagtggtac
ctttagagaaagttgaagatgaaactgtgcaatggtgtaaagagattatgaaacactcac
caacagcgttacgattccttaaagcagctatgaatgctgacacagatggtttagctggtt
tacaacaaatggctggggatgcaacattgctttattacacaactgatgaagcgaaagaag
gccgtgatgcgtttaaagaaaaacgtgatcctgacttcgatcaattccctaaattcccat
aagttattttgaatatgatattaagtcacttgcgtcgtttattagcgacgataggtggct
tttttattttataagaatttaaaagggcattttaattaattatcataaagataagatagt
ttgagaaaaattaatagagaaagaataaatgttaaagattattattacaatgaaaaaacg
agctggtgagaaattgaattctcgccaacccgctttatgaagtgaaatcatttaaattag
ttatactaagcgctcataaacgattggtcgcgaagtgccaataccttgtttggatgacgt
ttgcatgaggatatgctgtgtatcatcataatcaagaatataaatgatttcttcattatc
aatagatgaaaatttaatgcgttgatgtgccgtatctataaaaagaatatgatattgatt
gtgacttgtatcatcgccatgacgtatacaaattgatttttgtaattgatgattactcca
attaccaatgaataaattgata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008935       F:naphthoate synthase activity
GO:0009234       P:menaquinone biosynthetic process
GO:0016853       F:isomerase activity
cmr|NT05SA0893 Staphylococcus aureus NCTC 8325     naphthoate synthase
cmr|NT08SA0998 Staphylococcus aureus subsp. aureus MRSA252     naphthoate synthase
cmr|SACOL1054 Staphylococcus aureus subsp. aureus COL     naphthoate synthase
cmr|SAUSA300_0948 Staphylococcus aureus subsp. aureus USA300-FPR3757     naphthoate synthase
dbj|BAF67187.1 Staphylococcus aureus subsp. aureus str. Newman     naphthoate synthase
emb|CAG40023.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative naphthoate synthase
fig|282458.1.peg.953 Staphylococcus aureus subsp. aureus MRSA252 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|282458.4.peg.1017 Staphylococcus aureus subsp. aureus MRSA252 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|367830.3.peg.1513 Staphylococcus aureus subsp. aureus USA300 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|426430.6.peg.885 Staphylococcus aureus subsp. aureus str. Newman FIG   Naphthoate synthase (EC 4.1.3.36)
fig|450394.6.peg.238 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|451515.3.peg.1041 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|451516.9.peg.1045 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|452948.4.peg.2057 Staphylococcus aureus 930918-3 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|455227.3.peg.1405 Staphylococcus aureus D30 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|546342.3.peg.1015 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|546343.3.peg.1882 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|548470.3.peg.2597 Staphylococcus aureus subsp. aureus MN8 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|548473.3.peg.2309 Staphylococcus aureus subsp. aureus TCH60 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|548474.3.peg.1271 Staphylococcus aureus subsp. aureus TCH130 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|553567.3.peg.1504 Staphylococcus aureus A5948 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|553583.3.peg.1063 Staphylococcus aureus A9635 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|553590.4.peg.89 Staphylococcus aureus A9754 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|553594.3.peg.2028 Staphylococcus aureus A9765 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585143.3.peg.1494 Staphylococcus aureus subsp. aureus 55/2053 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585144.3.peg.1863 Staphylococcus aureus subsp. aureus 58-424 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585145.3.peg.1487 Staphylococcus aureus subsp. aureus 65-1322 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585146.3.peg.1492 Staphylococcus aureus subsp. aureus 68-397 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585147.3.peg.527 Staphylococcus aureus subsp. aureus A017934/97 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585149.6.peg.1129 Staphylococcus aureus subsp. aureus C101 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585150.3.peg.1552 Staphylococcus aureus subsp. aureus C160 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585151.3.peg.582 Staphylococcus aureus subsp. aureus C427 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585152.3.peg.893 Staphylococcus aureus subsp. aureus D139 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585153.3.peg.1553 Staphylococcus aureus subsp. aureus E1410 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585154.3.peg.962 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585155.3.peg.2316 Staphylococcus aureus subsp. aureus H19 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585156.3.peg.511 Staphylococcus aureus subsp. aureus M1015 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585157.3.peg.633 Staphylococcus aureus subsp. aureus M809 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585158.3.peg.1481 Staphylococcus aureus subsp. aureus M876 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585159.3.peg.1096 Staphylococcus aureus subsp. aureus M899 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585160.3.peg.508 Staphylococcus aureus subsp. aureus WBG10049 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|585161.3.peg.713 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|644279.4.peg.1050 Staphylococcus aureus subsp. aureus 132 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|93061.3.peg.947 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|93061.5.peg.905 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Naphthoate synthase (EC 4.1.3.36)
fig|93062.19.peg.1025 Staphylococcus aureus subsp. aureus COL FIG   Naphthoate synthase (EC 4.1.3.36)
fig|93062.4.peg.1223 Staphylococcus aureus subsp. aureus COL FIG   Naphthoate synthase (EC 4.1.3.36)
gb|AAW36519.1 Staphylococcus aureus subsp. aureus COL     naphthoate synthase
gb|ABD21938.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     naphthoate synthase
gb|ABD30110.1 Staphylococcus aureus subsp. aureus NCTC 8325     enoyl-CoA hydratase/isomerase family protein, putative
gb|ABX29013.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     naphthoate synthase
gb|EEI94456.1 Staphylococcus aureus subsp. aureus MN8     naphthoate synthase
gb|EEJ60985.1 Staphylococcus aureus subsp. aureus TCH60     naphthoate synthase
gb|EES93380.1 Staphylococcus aureus subsp. aureus USA300_TCH959     naphthoate synthase
gb|EES98101.1 Staphylococcus aureus subsp. aureus TCH130     naphthoate synthase
gb|EEV04207.1 Staphylococcus aureus subsp. aureus 55/2053     naphthoate synthase
gb|EEV06091.1 Staphylococcus aureus subsp. aureus 65-1322     naphthoate synthase
gb|EEV09144.1 Staphylococcus aureus subsp. aureus 68-397     naphthoate synthase
gb|EEV11330.1 Staphylococcus aureus subsp. aureus E1410     naphthoate synthase
gb|EEV14400.1 Staphylococcus aureus subsp. aureus M876     naphthoate synthase
gb|EEV70272.1 Staphylococcus aureus A9635     naphthoate synthase
gb|EEV83052.1 Staphylococcus aureus A5948     naphthoate synthase
gb|EEW44328.1 Staphylococcus aureus 930918-3     naphthoate synthase
gb|EEW47066.1 Staphylococcus aureus D30     naphthoate synthase
gi|150373927 Staphylococcus aureus subsp. aureus str. Newman NCBI   naphthoate synthase
gi|151221127 Staphylococcus aureus subsp. aureus str. Newman NCBI   naphthoate synthase
gi|160286114 organism not parsed/found in ncbi nr NCBI   Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa
gi|160286115 organism not parsed/found in ncbi nr NCBI   Chain B, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa
gi|160368042 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   naphthoate synthase
gi|161509233 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   naphthoate synthase
gi|221138023 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   naphthoate synthase
gi|221141829 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   naphthoate synthase
gi|227244697 Staphylococcus aureus subsp. aureus MN8 NCBI   naphthoate synthase
gi|227558912 Staphylococcus aureus subsp. aureus MN8 NCBI   naphthoate synthase
gi|227851187 Staphylococcus aureus subsp. aureus TCH60 NCBI   naphthoate synthase
gi|227900537 Staphylococcus aureus subsp. aureus TCH60 NCBI   naphthoate synthase
gi|253724651 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   naphthoate synthase
gi|253729372 Staphylococcus aureus subsp. aureus TCH130 NCBI   naphthoate synthase
gi|253731652 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   naphthoate synthase
gi|253732594 Staphylococcus aureus subsp. aureus TCH130 NCBI   naphthoate synthase
gi|257272075 Staphylococcus aureus subsp. aureus 55/2053 NCBI   naphthoate synthase
gi|257274604 Staphylococcus aureus subsp. aureus 65-1322 NCBI   naphthoate synthase
gi|257278525 Staphylococcus aureus subsp. aureus 68-397 NCBI   naphthoate synthase
gi|257281193 Staphylococcus aureus subsp. aureus E1410 NCBI   naphthoate synthase
gi|257284280 Staphylococcus aureus subsp. aureus M876 NCBI   naphthoate synthase
gi|257425099 Staphylococcus aureus subsp. aureus 55/2053 NCBI   naphthoate synthase
gi|257427763 Staphylococcus aureus subsp. aureus 65-1322 NCBI   naphthoate synthase
gi|257430397 Staphylococcus aureus subsp. aureus 68-397 NCBI   naphthoate synthase
gi|257433100 Staphylococcus aureus subsp. aureus E1410 NCBI   naphthoate synthase
gi|257435998 Staphylococcus aureus subsp. aureus M876 NCBI   naphthoate synthase
gi|257846248 Staphylococcus aureus A9635 NCBI   naphthoate synthase
gi|257860220 Staphylococcus aureus A5948 NCBI   naphthoate synthase
gi|258423547 Staphylococcus aureus A9635 NCBI   naphthoate synthase
gi|258452005 Staphylococcus aureus A5948 NCBI   naphthoate synthase
gi|259159270 Staphylococcus aureus 930918-3 NCBI   naphthoate synthase
gi|259162497 Staphylococcus aureus D30 NCBI   naphthoate synthase
gi|49241340 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative naphthoate synthase
gi|49483211 Staphylococcus aureus subsp. aureus MRSA252 NCBI   naphthoate synthase
gi|57284425 Staphylococcus aureus subsp. aureus COL NCBI   naphthoate synthase
gi|57650239 Staphylococcus aureus subsp. aureus COL NCBI   naphthoate synthase
gi|81651383 organism not parsed/found in ncbi nr NCBI   RecName: Full=Naphthoate synthase; AltName: Full=Dihydroxynaphthoic acid synthetase; Short=DHNA synthetase
gi|81694791 organism not parsed/found in ncbi nr NCBI   RecName: Full=Naphthoate synthase; AltName: Full=Dihydroxynaphthoic acid synthetase; Short=DHNA synthetase
gi|87127424 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   naphthoate synthase
gi|87161450 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   naphthoate synthase
gi|87202300 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   enoyl-CoA hydratase/isomerase family protein, putative
gi|88194742 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   naphthoate synthase
img|637151818 Staphylococcus aureus aureus COL IMG   naphthoate synthase( EC:4.1.3.36 )
img|637154459 Staphylococcus aureus aureus MRSA252 IMG   naphthoate synthase( EC:4.1.3.36 )
img|637887600 Staphylococcus aureus aureus USA300 IMG   naphthoate synthase( EC:4.1.3.36 )
img|637893631 Staphylococcus aureus aureus NCTC 8325 IMG   enoyl-CoA hydratase/isomerase family protein, putative( EC:4.1.3.36 )
img|640795295 Staphylococcus aureus aureus Newman IMG   naphthoate synthase( EC:4.1.3.36 )
img|641308963 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   naphthoate synthase( EC:4.1.3.36 )
img|641772567 Staphylococcus aureus aureus USA300_TCH959 IMG   naphthoate synthase( EC:4.1.3.36 )
kegg|saa:SAUSA300_0948 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   naphthoate synthase (EC:4.1.3.36)
kegg|sac:SACOL1054 Staphylococcus aureus subsp. aureus COL KEGG   naphthoate synthase (EC:4.1.3.36)
kegg|sae:NWMN_0915 Staphylococcus aureus subsp. aureus Newman KEGG   naphthoate synthase (EC:4.1.3.36)
kegg|sao:SAOUHSC_00985 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   naphthoate synthase (EC:4.1.3.36)
kegg|sar:SAR1019   KEGG   naphthoate synthase (EC:4.1.3.36)
kegg|sax:USA300HOU_0993 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   naphthoate synthase (EC:4.1.3.36)
pdb|2UZF organism not parsed/found in ncbi nr     Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa
pdb|A ((R)-1-Benzyloxycarbonylamino-Hexyl)- Hydroxy-Phosphinoyloxy     Chain A,
pdb|B ((R)-1-Benzyloxycarbonylamino-Hexyl)- Hydroxy-Phosphinoyloxy     Chain B,
ref|YP_001331949.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   naphthoate synthase
ref|YP_001574892.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   naphthoate synthase
ref|YP_040435.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   naphthoate synthase
ref|YP_185919.1 Staphylococcus aureus subsp. aureus COL RefSeq   naphthoate synthase
ref|YP_493646.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   naphthoate synthase
ref|YP_499538.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   naphthoate synthase
ref|ZP_03562825.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   naphthoate synthase
ref|ZP_03566322.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   naphthoate synthase
ref|ZP_03988959.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   naphthoate synthase
ref|ZP_04018342.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   naphthoate synthase
ref|ZP_04865817.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   naphthoate synthase
ref|ZP_04866759.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   naphthoate synthase
ref|ZP_05601525.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   naphthoate synthase
ref|ZP_05604161.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   naphthoate synthase
ref|ZP_05606779.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   naphthoate synthase
ref|ZP_05609458.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   naphthoate synthase
ref|ZP_05612045.1 Staphylococcus aureus subsp. aureus M876 RefSeq   naphthoate synthase
ref|ZP_05686437.1 Staphylococcus aureus A9635 RefSeq   naphthoate synthase
ref|ZP_05700021.1 Staphylococcus aureus A5948 RefSeq   naphthoate synthase
sp|MENB_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Naphthoate synthase; AltName: Full=Dihydroxynaphthoic acid synthetase; Short=DHNA synthetase
sp|MENB_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Naphthoate synthase; AltName: Full=Dihydroxynaphthoic acid synthetase; Short=DHNA synthetase
sp|Q5HH38 Staphylococcus aureus (strain COL) SwissProt   Naphthoate synthase
sp|Q6GI37 Staphylococcus aureus (strain MRSA252) SwissProt   Naphthoate synthase
tr|A6QFQ5 Staphylococcus aureus (strain Newman) TrEMBL   Naphthoate synthase
tr|A8Z0D9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Naphthoate synthase
tr|C2GDA9 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Naphthoate synthase
tr|C2KA19 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Naphthoate synthase
tr|C5N4C5 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Naphthoate synthase
tr|C5PXZ9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Naphthoate synthase
tr|Q2FI32 Staphylococcus aureus (strain USA300) TrEMBL   Naphthoate synthase
tr|Q2FZL5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Enoyl-CoA hydratase/isomerase family protein, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|426430.8.peg.985 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)
4 fig|426430.8.peg.986 Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2)
25 fig|426430.8.peg.987 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
6 fig|426430.8.peg.988 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(20643650);moussulubin


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search