The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2514: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: amino acid ABC transporter, permease protein
Translate Function Assignments



Context on contig NC_009641 from base 2533123 to 2544463 (11341 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2507 2534718 2533123 1596 -           Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96 29 1: 3   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4       amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20 30     L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417
2516 2542050 2540713 1338 - 120         FIG01107989: hypothetical protein locus|NWMN_2314, protein_id|YP_001333348.1, gi|151222526, geneID|5331418
2517 2542174 2542037 138 - -14         hypothetical protein  
2518 2542327 2542431 105 + 152         hypothetical protein  
2519 2543271 2542585 687 - 153     2: 6 5   Phosphoglycerate mutase (EC 5.4.2.11) gene_name|gpmA, locus|NWMN_2315, protein_id|YP_001333349.1, gi|151222527, geneID|5331419
2520 2544463 2543597 867 - 325     3: 1 4 2 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|NWMN_2316, protein_id|YP_001333350.1, gi|151222528, geneID|5331973

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2514 amino acid ABC transporter, permease protein
MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTSKIL
RSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLNVGA
YASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIKDTS
LLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGYRS

MD5 = ee9519d43768d6330098bbb8e5a88441


  DNA Sequence

>fig|426430.8.peg.2514 amino acid ABC transporter, permease protein
atgtttctaaatctaaatagtgaacaacaacatgcgctagatgctgcaaaacaagctttc
ggacctatgctagaaggtttggtcaaatattcaattcctattacattagttacatttgtt
ttaggattgattattgcattatttacagcattaatgcgaatttcaacgagtaaaatttta
agaagtatttcacgtgtctatgtatctattattcgaggaacaccaatgatagtacaacta
tttatcatattttatggtattccagaattaggtagattattaacaaatgacgctgacaac
caatggacattggcacctgtagtggctgctattattggtttatcattaaatgtaggtgcg
tatgcttcggaaattattcgtggcggtattatttctataccgaaaggacaaacagaagct
gcatattccatcggtatgacgtatggtcaaacgatacaacgtatcattttaccgcaggca
attcgagtgtcgattcctgcactaggtaatacatttttaagtttaatcaaagatacatca
ttattaggatttattttagtggctgaaatgtttagaaaagctcaagaagttgcgtctaca
acatatgaatatttaacaatttatgtgttagttgcgctaatgtactgggtggtatgcttt
attatttcaattatccaaggtatctatgaatcttatattgaaagagggtatcgctcatga


  DNA with Flanking Sequence

>fig|426430.8.peg.2514 amino acid ABC transporter, permease protein
tttagacgcagggcgttttgatgtaatcgcgaaccaagtaggtattaatcctgatagaga
aaagaaatataaattttctaagccttacacattctcaagtgctgttttagttattcgtga
aaatgaaaaagatattaaagattttgatgatgttaaaggtaagaagttagcacaaacatt
cacatctaattatggtaaattagctaaggataaaggtgctgatattacaaaagttgatgg
ctttaaccaatcaatggatttattattgtctaagcgtgttgatggtacatttaatgatag
tctgtcatacttggattataaaaaacaaaaacctaatgctaagatcaaagcaatcaaagg
taatgctgaacaaagtagatctgcatttgcattttctaaaaaagcagatgatgaaacagt
tcaaaaattcaatgatggcttgaaaaaaatcgaggaaaacggtgaattagctaaaatagg
taagaaatggtttggtcaagatgtttctaaatctaaatagtgaacaacaacatgcgctag
atgctgcaaaacaagctttcggacctatgctagaaggtttggtcaaatattcaattccta
ttacattagttacatttgttttaggattgattattgcattatttacagcattaatgcgaa
tttcaacgagtaaaattttaagaagtatttcacgtgtctatgtatctattattcgaggaa
caccaatgatagtacaactatttatcatattttatggtattccagaattaggtagattat
taacaaatgacgctgacaaccaatggacattggcacctgtagtggctgctattattggtt
tatcattaaatgtaggtgcgtatgcttcggaaattattcgtggcggtattatttctatac
cgaaaggacaaacagaagctgcatattccatcggtatgacgtatggtcaaacgatacaac
gtatcattttaccgcaggcaattcgagtgtcgattcctgcactaggtaatacatttttaa
gtttaatcaaagatacatcattattaggatttattttagtggctgaaatgtttagaaaag
ctcaagaagttgcgtctacaacatatgaatatttaacaatttatgtgttagttgcgctaa
tgtactgggtggtatgctttattatttcaattatccaaggtatctatgaatcttatattg
aaagagggtatcgctcatgattcaattgaacaatatccataaatcatttaatgatgttga
agtcatcaaaggtattgatttatctgttgaacaaggtgaggttgtaaccttaatcggtcg
atctggttcaggtaaaacaacattgttacgtatgattaatgcattagaaattccaactga
aggtacagtttatgttaacggcaaaacatatacatctaaagataaaaaatcacaaataga
agttcgtaaacagtctggtatggtatttcaaagttataacctttttccgcataagacggc
attagaaaatgtaatggaaggtcttatcacagttaaaaagttgaaaaaggatgaggcacg
tgggaaatcacttgagttacttgagaaagttggtttaacacatgtcaaagatcaacgtcc
acatgcattatcaggtggtcaacaacaacgtgttgctattgcaagagcactagcaatgaa
ccctaaagtgatgttgtttgatgaaccaacatctgcactt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005215       F:transporter activity
GO:0005886       C:plasma membrane
GO:0006810       P:transport
GO:0009276       C:Gram-negative-bacterium-type cell wall
GO:0016021       C:integral to membrane
cmr|NT01SA2427 Staphylococcus aureus N315     amino acid ABC transproter, permease protein
cmr|NT02SA2410 Staphylococcus aureus Mu50     ABC transporter (permease protein)
cmr|NT03SA2514 Staphylococcus aureus MW2     amino acid ABC transproter, permease protein
cmr|NT05SA2433 Staphylococcus aureus NCTC 8325     probable amino-acid ABC transporter permease protein YckJ
cmr|NT09SA2314 Staphylococcus aureus subsp. aureus MSSA476     amino acid ABC transporter, permease protein
cmr|SAUSA300_2358 Staphylococcus aureus subsp. aureus USA300-FPR3757     ABC transporter, permease protein
dbj|BAF68584.1 Staphylococcus aureus subsp. aureus str. Newman     amino acid ABC transporter, permease protein
emb|CAG44117.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   transport system membrane protein
fig|158878.14.peg.2497 Staphylococcus aureus subsp. aureus Mu50 FIG   amino acid ABC transporter, permease protein
fig|158879.11.peg.2386 Staphylococcus aureus subsp. aureus N315 FIG   amino acid ABC transporter, permease protein
fig|196620.5.peg.2412 Staphylococcus aureus subsp. aureus MW2 FIG   amino acid ABC transporter, permease protein
fig|282459.5.peg.2396 Staphylococcus aureus subsp. aureus MSSA476 FIG   amino acid ABC transporter, permease protein
fig|359786.13.peg.2577 Staphylococcus aureus subsp. aureus JH9 FIG   amino acid ABC transporter, permease protein
fig|359786.3.peg.1519 Staphylococcus aureus subsp. aureus JH9 FIG   amino acid ABC transporter, permease protein
fig|359787.11.peg.2540 Staphylococcus aureus subsp. aureus JH1 FIG   amino acid ABC transporter, permease protein
fig|359787.3.peg.661 Staphylococcus aureus subsp. aureus JH1 FIG   amino acid ABC transporter, permease protein
fig|367830.3.peg.509 Staphylococcus aureus subsp. aureus USA300 FIG   amino acid ABC transporter, permease protein
fig|418127.4.peg.2214 Staphylococcus aureus subsp. aureus Mu3 FIG   amino acid ABC transporter, permease protein
fig|418127.6.peg.2460 Staphylococcus aureus subsp. aureus Mu3 FIG   amino acid ABC transporter, permease protein
fig|426430.6.peg.2239 Staphylococcus aureus subsp. aureus str. Newman FIG   amino acid ABC transporter, permease protein
fig|450394.6.peg.2197 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   amino acid ABC transporter, permease protein
fig|451515.3.peg.2516 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   amino acid ABC transporter, permease protein
fig|451516.9.peg.2505 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   amino acid ABC transporter, permease protein
fig|452948.4.peg.540 Staphylococcus aureus 930918-3 FIG   amino acid ABC transporter, permease protein
fig|455227.3.peg.797 Staphylococcus aureus D30 FIG   amino acid ABC transporter, permease protein
fig|505321.3.peg.199 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   amino acid ABC transporter, permease protein
fig|546342.3.peg.1519 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   amino acid ABC transporter, permease protein
fig|546343.3.peg.1339 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   amino acid ABC transporter, permease protein
fig|548474.3.peg.465 Staphylococcus aureus subsp. aureus TCH130 FIG   amino acid ABC transporter, permease protein
fig|548475.3.peg.1754 Staphylococcus aureus subsp. aureus TCH70 FIG   amino acid ABC transporter, permease protein
fig|553565.3.peg.1989 Staphylococcus aureus A5937 FIG   amino acid ABC transporter, permease protein
fig|553567.3.peg.768 Staphylococcus aureus A5948 FIG   amino acid ABC transporter, permease protein
fig|553568.3.peg.2745 Staphylococcus aureus A6224 FIG   amino acid ABC transporter, permease protein
fig|553571.3.peg.1512 Staphylococcus aureus A6300 FIG   amino acid ABC transporter, permease protein
fig|553573.3.peg.805 Staphylococcus aureus A8115 FIG   amino acid ABC transporter, permease protein
fig|553577.3.peg.242 Staphylococcus aureus A8796 FIG   amino acid ABC transporter, permease protein
fig|553580.3.peg.243 Staphylococcus aureus A8819 FIG   amino acid ABC transporter, permease protein
fig|553581.3.peg.2479 Staphylococcus aureus A9299 FIG   amino acid ABC transporter, permease protein
fig|553588.3.peg.2569 Staphylococcus aureus A9719 FIG   amino acid ABC transporter, permease protein
fig|553590.4.peg.1019 Staphylococcus aureus A9754 FIG   amino acid ABC transporter, permease protein
fig|553592.3.peg.558 Staphylococcus aureus A9763 FIG   amino acid ABC transporter, permease protein
fig|553594.3.peg.370 Staphylococcus aureus A9765 FIG   amino acid ABC transporter, permease protein
fig|553596.3.peg.1661 Staphylococcus aureus A9781 FIG   amino acid ABC transporter, permease protein
fig|553601.3.peg.1909 Staphylococcus aureus A10102 FIG   amino acid ABC transporter, permease protein
fig|585891.3.peg.2491 Staphylococcus aureus subsp. aureus Mu50-omega FIG   amino acid ABC transporter, permease protein
fig|644279.4.peg.2556 Staphylococcus aureus subsp. aureus 132 FIG   amino acid ABC transporter, permease protein
fig|680649.3.peg.2296 Staphylococcus aureus subsp. aureus MR1 FIG   amino acid ABC transporter, permease protein
fig|681288.4.peg.2440 Staphylococcus aureus subsp. aureus ED98 FIG   amino acid ABC transporter, permease protein
fig|703339.3.peg.2401 Staphylococcus aureus 04-02981 FIG   amino acid ABC transporter, permease protein
fig|762962.3.peg.2095 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   amino acid ABC transporter, permease protein
fig|93061.3.peg.2552 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   amino acid ABC transporter, permease protein
fig|93061.5.peg.2444 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   amino acid ABC transporter, permease protein
fig|93062.19.peg.2354 Staphylococcus aureus subsp. aureus COL FIG   amino acid ABC transporter, permease protein
gb|ABD20777.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     ABC transporter, permease protein
gb|ABD31706.1 Staphylococcus aureus subsp. aureus NCTC 8325     amino acid ABC transproter, permease protein, putative
gb|ABQ50215.1 Staphylococcus aureus subsp. aureus JH9     polar amino acid ABC transporter, inner membrane subunit
gb|ABR53310.1 Staphylococcus aureus subsp. aureus JH1     polar amino acid ABC transporter, inner membrane subunit
gb|EES55991.1 Staphylococcus aureus subsp. aureus TCH70     ABC superfamily ATP binding cassette transporter, membrane protein
gb|EES94902.1 Staphylococcus aureus subsp. aureus USA300_TCH959     ABC superfamily ATP binding cassette transporter, membrane protein
gb|EES96595.1 Staphylococcus aureus subsp. aureus TCH130     ABC superfamily ATP binding cassette transporter, membrane protein
gb|EEV27065.1 Staphylococcus aureus A9781     amino acid ABC transporter
gb|EEV71409.1 Staphylococcus aureus A9299     transport system membrane protein
gb|EEV75867.1 Staphylococcus aureus A8115     ABC transporter
gb|EEV77504.1 Staphylococcus aureus A6300     ABC transporter
gb|EEV79396.1 Staphylococcus aureus A6224     transport system membrane protein
gb|EEV83889.1 Staphylococcus aureus A5948     transport system membrane protein
gb|EEV85208.1 Staphylococcus aureus A5937     amino acid ABC transporter
gi|147741917 Staphylococcus aureus subsp. aureus JH9 NCBI   polar amino acid ABC transporter, inner membrane subunit
gi|148268848 Staphylococcus aureus subsp. aureus JH9 NCBI   polar amino acid ABC transporter, inner membrane subunit
gi|149947374 Staphylococcus aureus subsp. aureus JH1 NCBI   polar amino acid ABC transporter, inner membrane subunit
gi|150375324 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, permease protein
gi|150394922 Staphylococcus aureus subsp. aureus JH1 NCBI   polar amino acid ABC transporter, inner membrane subunit
gi|151222524 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, permease protein
gi|221138496 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   ABC transporter ATP-binding protein
gi|221141309 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   ABC transporter ATP-binding protein
gi|251803334 Staphylococcus aureus subsp. aureus TCH70 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|251813151 Staphylococcus aureus subsp. aureus TCH70 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|253314750 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   ABC transporter ATP-binding protein
gi|253726173 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|253727866 Staphylococcus aureus subsp. aureus TCH130 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|253730086 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|253734171 Staphylococcus aureus subsp. aureus TCH130 NCBI   ABC superfamily ATP binding cassette transporter, membrane protein
gi|255007187 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   ABC transporter ATP-binding protein
gi|257788725 Staphylococcus aureus A9781 NCBI   amino acid ABC transporter
gi|257794753 Staphylococcus aureus A9781 NCBI   amino acid ABC transporter
gi|257847407 Staphylococcus aureus A9299 NCBI   transport system membrane protein
gi|257851933 Staphylococcus aureus A8115 NCBI   ABC transporter
gi|257854556 Staphylococcus aureus A6300 NCBI   ABC transporter
gi|257856487 Staphylococcus aureus A6224 NCBI   transport system membrane protein
gi|257861074 Staphylococcus aureus A5948 NCBI   transport system membrane protein
gi|257862440 Staphylococcus aureus A5937 NCBI   amino acid ABC transporter
gi|258439631 Staphylococcus aureus A9299 NCBI   transport system membrane protein
gi|258442812 Staphylococcus aureus A8115 NCBI   ABC transporter
gi|258446488 Staphylococcus aureus A6300 NCBI   ABC transporter
gi|258450395 Staphylococcus aureus A6224 NCBI   transport system membrane protein
gi|258451282 Staphylococcus aureus A5948 NCBI   transport system membrane protein
gi|258455229 Staphylococcus aureus A5937 NCBI   amino acid ABC transporter
gi|49245638 Staphylococcus aureus subsp. aureus MSSA476 NCBI   transport system membrane protein
gi|49487195 Staphylococcus aureus subsp. aureus MSSA476 NCBI   transport system membrane protein
gi|87126263 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ABC transporter, permease protein
gi|87160289 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ABC transporter, permease protein
gi|87203896 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid ABC transproter, permease protein, putative
gi|88196338 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid ABC transproter, permease protein, putative
img|637158573 Staphylococcus aureus aureus MSSA476 IMG   transport system membrane protein
img|637889001 Staphylococcus aureus aureus USA300 IMG   ABC transporter, permease protein
img|637895309 Staphylococcus aureus aureus NCTC 8325 IMG   amino acid ABC transproter, permease protein, putative
img|639109475 Staphylococcus aureus aureus JH1 IMG   Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine
img|640566823 Staphylococcus aureus aureus JH9 IMG   polar amino acid ABC transporter, inner membrane subunit
img|640780597 Staphylococcus aureus aureus JH1 IMG   polar amino acid ABC transporter, inner membrane subunit
img|640796743 Staphylococcus aureus aureus Newman IMG   amino acid ABC transporter, permease protein
img|641773041 Staphylococcus aureus aureus USA300_TCH959 IMG   amino acid ABC transporter, permease protein
kegg|saa:SAUSA300_2358 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   ABC transporter, permease protein
kegg|sae:NWMN_2312 Staphylococcus aureus subsp. aureus Newman KEGG   amino acid ABC transporter, permease protein
kegg|sah:SaurJH1_2486 Staphylococcus aureus subsp. aureus JH1 KEGG   polar amino acid ABC transporter, inner membrane subunit
kegg|saj:SaurJH9_2438 Staphylococcus aureus subsp. aureus JH9 KEGG   polar amino acid ABC transporter, inner membrane subunit
kegg|sao:SAOUHSC_02698 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   amino acid ABC transproter, permease protein, putative
kegg|sas:SAS2304   KEGG   transport system membrane protein
ref|YP_001247791.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   polar amino acid ABC transporter, inner membrane subunit
ref|YP_001317597.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   polar amino acid ABC transporter, inner membrane subunit
ref|YP_001333346.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   amino acid ABC transporter, permease protein
ref|YP_044416.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   transport system membrane protein
ref|YP_494993.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   ABC transporter, permease protein
ref|YP_501160.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   amino acid ABC transproter, permease protein, putative
ref|ZP_03563298.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   ABC transporter ATP-binding protein
ref|ZP_03565802.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   ABC transporter ATP-binding protein
ref|ZP_04827624.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   ABC superfamily ATP binding cassette transporter, membrane protein
ref|ZP_04837963.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   ABC transporter ATP-binding protein
ref|ZP_04864251.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   ABC superfamily ATP binding cassette transporter, membrane protein
ref|ZP_04868336.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   ABC superfamily ATP binding cassette transporter, membrane protein
ref|ZP_05145788.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   ABC transporter ATP-binding protein
ref|ZP_05643732.1 Staphylococcus aureus A9781 RefSeq   amino acid ABC transporter
ref|ZP_05690377.1 Staphylococcus aureus A9299 RefSeq   transport system membrane protein
ref|ZP_05691372.1 Staphylococcus aureus A8115 RefSeq   ABC transporter
ref|ZP_05694643.1 Staphylococcus aureus A6300 RefSeq   ABC transporter
ref|ZP_05698487.1 Staphylococcus aureus A6224 RefSeq   transport system membrane protein
ref|ZP_05699315.1 Staphylococcus aureus A5948 RefSeq   transport system membrane protein
ref|ZP_05703189.1 Staphylococcus aureus A5937 RefSeq   amino acid ABC transporter
tr|A5IVJ2 Staphylococcus aureus (strain JH9) TrEMBL   Polar amino acid ABC transporter, inner membrane subunit
tr|A6QJQ2 Staphylococcus aureus (strain Newman) TrEMBL   Amino acid ABC transporter, permease protein
tr|A6U4E2 Staphylococcus aureus (strain JH1) TrEMBL   Polar amino acid ABC transporter, inner membrane subunit
tr|C5MZV9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   ABC superfamily ATP binding cassette transporter, membrane protein
tr|C5Q2G7 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   ABC superfamily ATP binding cassette transporter, membrane protein
tr|C5QFQ8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   ABC superfamily ATP binding cassette transporter, membrane protein
tr|Q2FE85 Staphylococcus aureus (strain USA300) TrEMBL   ABC transporter, permease protein
tr|Q2FVL3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Amino acid ABC transproter, permease protein, putative
tr|Q6G6Q8 Staphylococcus aureus (strain MSSA476) TrEMBL   Transport system membrane protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
29 fig|426430.8.peg.2513 L-cystine ABC transporter, ATP-binding protein TcyC
30 fig|426430.8.peg.2515 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search