The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2513: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: L-cystine ABC transporter, ATP-binding protein TcyC
Translate Function Assignments



Context on contig NC_009641 from base 2533123 to 2544463 (11341 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2507 2534718 2533123 1596 -           Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96   1: 4   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4 32     amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20 21     L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417
2516 2542050 2540713 1338 - 120         FIG01107989: hypothetical protein locus|NWMN_2314, protein_id|YP_001333348.1, gi|151222526, geneID|5331418
2517 2542174 2542037 138 - -14         hypothetical protein  
2518 2542327 2542431 105 + 152         hypothetical protein  
2519 2543271 2542585 687 - 153     2: 6 2   Phosphoglycerate mutase (EC 5.4.2.11) gene_name|gpmA, locus|NWMN_2315, protein_id|YP_001333349.1, gi|151222527, geneID|5331419
2520 2544463 2543597 867 - 325     3: 1 5 3 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|NWMN_2316, protein_id|YP_001333350.1, gi|151222528, geneID|5331973

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Molybdenum_cofactor_biosynthesis_ADH ADHanson Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)


  Protein Sequence

>fig|426430.8.peg.2513 L-cystine ABC transporter, ATP-binding protein TcyC
MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
NEE

MD5 = 3cb3645d47ce1ea9a6a50006c00eda0b


  DNA Sequence

>fig|426430.8.peg.2513 L-cystine ABC transporter, ATP-binding protein TcyC
atgattcaattgaacaatatccataaatcatttaatgatgttgaagtcatcaaaggtatt
gatttatctgttgaacaaggtgaggttgtaaccttaatcggtcgatctggttcaggtaaa
acaacattgttacgtatgattaatgcattagaaattccaactgaaggtacagtttatgtt
aacggcaaaacatatacatctaaagataaaaaatcacaaatagaagttcgtaaacagtct
ggtatggtatttcaaagttataacctttttccgcataagacggcattagaaaatgtaatg
gaaggtcttatcacagttaaaaagttgaaaaaggatgaggcacgtgggaaatcacttgag
ttacttgagaaagttggtttaacacatgtcaaagatcaacgtccacatgcattatcaggt
ggtcaacaacaacgtgttgctattgcaagagcactagcaatgaaccctaaagtgatgttg
tttgatgaaccaacatctgcacttgatcctgaacttgtgaatgatgttttaaaggttatt
aaagatttggctaatgaaggcatgacaatggtcattgtgacacatgaaatgcgttttgct
aaagaagtatctaataacattgtatttattcatgaaggcatgatcggagaacaaggggct
ccagaagagatgttcaatcgtccgaaaacagaagaattaagacgtttcttaaatgttata
aatgaagaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2513 L-cystine ABC transporter, ATP-binding protein TcyC
ggaacaccaatgatagtacaactatttatcatattttatggtattccagaattaggtaga
ttattaacaaatgacgctgacaaccaatggacattggcacctgtagtggctgctattatt
ggtttatcattaaatgtaggtgcgtatgcttcggaaattattcgtggcggtattatttct
ataccgaaaggacaaacagaagctgcatattccatcggtatgacgtatggtcaaacgata
caacgtatcattttaccgcaggcaattcgagtgtcgattcctgcactaggtaatacattt
ttaagtttaatcaaagatacatcattattaggatttattttagtggctgaaatgtttaga
aaagctcaagaagttgcgtctacaacatatgaatatttaacaatttatgtgttagttgcg
ctaatgtactgggtggtatgctttattatttcaattatccaaggtatctatgaatcttat
attgaaagagggtatcgctcatgattcaattgaacaatatccataaatcatttaatgatg
ttgaagtcatcaaaggtattgatttatctgttgaacaaggtgaggttgtaaccttaatcg
gtcgatctggttcaggtaaaacaacattgttacgtatgattaatgcattagaaattccaa
ctgaaggtacagtttatgttaacggcaaaacatatacatctaaagataaaaaatcacaaa
tagaagttcgtaaacagtctggtatggtatttcaaagttataacctttttccgcataaga
cggcattagaaaatgtaatggaaggtcttatcacagttaaaaagttgaaaaaggatgagg
cacgtgggaaatcacttgagttacttgagaaagttggtttaacacatgtcaaagatcaac
gtccacatgcattatcaggtggtcaacaacaacgtgttgctattgcaagagcactagcaa
tgaaccctaaagtgatgttgtttgatgaaccaacatctgcacttgatcctgaacttgtga
atgatgttttaaaggttattaaagatttggctaatgaaggcatgacaatggtcattgtga
cacatgaaatgcgttttgctaaagaagtatctaataacattgtatttattcatgaaggca
tgatcggagaacaaggggctccagaagagatgttcaatcgtccgaaaacagaagaattaa
gacgtttcttaaatgttataaatgaagaataatcaaatagaaccacgtatcatgttttag
tatggcgatgaagccatatacatgatgcgtggttctttgttatgttgtcataatcttgga
gcgatattttaacgacgtttatgatttaagtacgtttgtaccttatatagtaatggtttg
ataggcttaataaagtcaccgatatactcttctacatgtgcgttaaaaccttttttgaat
tgttggacgccatagtcttctgatgactctgaaaagtcaccggtaataccataaaaatta
tagcgatcaatatgatgcgctttagcaaacttaatcatttcccactgcaaatggtaggca
cccatataagcattatatttagggtttgaaccactagataagtaataaacttcatgctca
ttgtagataaataaagcagaagctaagtttaagactgcaccatcttgttcaatttgttct
attgtattgtcgattttacgcttattgctatttagctgttgttctagctgtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0016887       F:ATPase activity
cmr|NT01SA2426 Staphylococcus aureus N315     amino acid ABC transporter, ATP-binding protein
cmr|NT02SA2409 Staphylococcus aureus Mu50     ABC transporter (ATP binding subunit)
cmr|NT05SA2432 Staphylococcus aureus NCTC 8325     amino acid ABC transporter, ATP-binding protein
cmr|SAUSA300_2357 Staphylococcus aureus subsp. aureus USA300-FPR3757     ABC transporter, ATP-binding protein
dbj|BAB43502.1 Staphylococcus aureus subsp. aureus N315     SA2200
dbj|BAB58574.1 Staphylococcus aureus subsp. aureus Mu50     ABC transporter (ATP binding subunit)
dbj|BAF68583.1 Staphylococcus aureus subsp. aureus str. Newman     amino acid ABC transporter, ATP-binding protein
dbj|BAF79279.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2412 Staphylococcus aureus subsp. aureus Mu50 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|158878.14.peg.2496 Staphylococcus aureus subsp. aureus Mu50 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|158879.1.peg.2285 Staphylococcus aureus subsp. aureus N315 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|158879.11.peg.2385 Staphylococcus aureus subsp. aureus N315 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|359786.13.peg.2576 Staphylococcus aureus subsp. aureus JH9 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|359786.3.peg.1513 Staphylococcus aureus subsp. aureus JH9 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|359787.11.peg.2539 Staphylococcus aureus subsp. aureus JH1 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|359787.3.peg.662 Staphylococcus aureus subsp. aureus JH1 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|367830.3.peg.508 Staphylococcus aureus subsp. aureus USA300 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|418127.4.peg.2213 Staphylococcus aureus subsp. aureus Mu3 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|418127.6.peg.2459 Staphylococcus aureus subsp. aureus Mu3 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|426430.6.peg.2238 Staphylococcus aureus subsp. aureus str. Newman FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|450394.6.peg.2196 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|451515.3.peg.2515 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|451516.9.peg.2504 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|452948.4.peg.541 Staphylococcus aureus 930918-3 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|455227.3.peg.798 Staphylococcus aureus D30 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|505321.3.peg.198 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|546342.3.peg.1518 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|546343.3.peg.1340 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|548474.3.peg.466 Staphylococcus aureus subsp. aureus TCH130 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553565.3.peg.1990 Staphylococcus aureus A5937 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553567.3.peg.769 Staphylococcus aureus A5948 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553568.3.peg.2744 Staphylococcus aureus A6224 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553571.3.peg.1513 Staphylococcus aureus A6300 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553573.3.peg.804 Staphylococcus aureus A8115 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553574.3.peg.1201 Staphylococcus aureus A8117 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553577.3.peg.241 Staphylococcus aureus A8796 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553580.3.peg.242 Staphylococcus aureus A8819 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553581.3.peg.2480 Staphylococcus aureus A9299 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553588.3.peg.2570 Staphylococcus aureus A9719 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553590.4.peg.1018 Staphylococcus aureus A9754 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553592.3.peg.557 Staphylococcus aureus A9763 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553594.3.peg.369 Staphylococcus aureus A9765 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553596.3.peg.1660 Staphylococcus aureus A9781 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|553601.3.peg.1908 Staphylococcus aureus A10102 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|585891.3.peg.2490 Staphylococcus aureus subsp. aureus Mu50-omega FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|644279.4.peg.2555 Staphylococcus aureus subsp. aureus 132 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|681288.4.peg.2439 Staphylococcus aureus subsp. aureus ED98 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|703339.3.peg.2400 Staphylococcus aureus 04-02981 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|93061.3.peg.2551 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
fig|93061.5.peg.2443 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   L-cystine ABC transporter, ATP-binding protein TcyC
gb|ABD20492.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     ABC transporter, ATP-binding protein
gb|ABD31705.1 Staphylococcus aureus subsp. aureus NCTC 8325     amino acid ABC transporter, ATP-binding protein, putative
gb|ABQ50214.1 Staphylococcus aureus subsp. aureus JH9     ABC transporter related
gb|ABR53309.1 Staphylococcus aureus subsp. aureus JH1     ABC transporter related
gb|ABX30383.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ABC superfamily ATP binding cassette transporter, ABC protein
gb|EES94901.1 Staphylococcus aureus subsp. aureus USA300_TCH959     ABC superfamily ATP binding cassette transporter, ABC protein
gb|EES96596.1 Staphylococcus aureus subsp. aureus TCH130     ABC superfamily ATP binding cassette transporter, ABC protein
gb|EEV27064.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65395.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66108.1 Staphylococcus aureus A9719     amino acid ABC transporter
gb|EEV71410.1 Staphylococcus aureus A9299     amino acid ABC transporter
gb|EEV75866.1 Staphylococcus aureus A8115     ABC transporter
gb|EEV77505.1 Staphylococcus aureus A6300     ABC transporter
gb|EEV79395.1 Staphylococcus aureus A6224     ABC transporter ATP-binding protein
gb|EEV83890.1 Staphylococcus aureus A5948     ABC transporter
gb|EEV85209.1 Staphylococcus aureus A5937     ABC transporter
gb|EEW45571.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1332
gb|EEW47639.1 Staphylococcus aureus D30     hypothetical protein SAD30_0667
gi|13702361 Staphylococcus aureus subsp. aureus N315 NCBI   SA2200
gi|14248186 Staphylococcus aureus subsp. aureus Mu50 NCBI   ABC transporter (ATP binding subunit)
gi|147741916 Staphylococcus aureus subsp. aureus JH9 NCBI   ABC transporter related
gi|148268847 Staphylococcus aureus subsp. aureus JH9 NCBI   ABC transporter related
gi|149947373 Staphylococcus aureus subsp. aureus JH1 NCBI   ABC transporter related
gi|150375323 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, ATP-binding protein
gi|150394921 Staphylococcus aureus subsp. aureus JH1 NCBI   ABC transporter related
gi|151222523 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, ATP-binding protein
gi|156722862 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980727 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2396
gi|15925402 Staphylococcus aureus subsp. aureus Mu50 NCBI   ABC transporter (ATP binding subunit)
gi|15927990 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2200
gi|160369412 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|161510603 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ABC transporter ATP-binding protein
gi|221138495 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   ABC transporter ATP-binding protein
gi|221141310 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   ABC transporter ATP-binding protein
gi|253314749 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   ABC transporter, ATP-binding protein
gi|253726172 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|253727867 Staphylococcus aureus subsp. aureus TCH130 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|253730085 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|253734172 Staphylococcus aureus subsp. aureus TCH130 NCBI   ABC superfamily ATP binding cassette transporter, ABC protein
gi|255007186 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   ABC transporter, ATP-binding protein
gi|257788724 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794752 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840944 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257841671 Staphylococcus aureus A9719 NCBI   amino acid ABC transporter
gi|257847408 Staphylococcus aureus A9299 NCBI   amino acid ABC transporter
gi|257851932 Staphylococcus aureus A8115 NCBI   ABC transporter
gi|257854557 Staphylococcus aureus A6300 NCBI   ABC transporter
gi|257856486 Staphylococcus aureus A6224 NCBI   ABC transporter ATP-binding protein
gi|257861075 Staphylococcus aureus A5948 NCBI   ABC transporter
gi|257862441 Staphylococcus aureus A5937 NCBI   ABC transporter
gi|258407432 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258422240 Staphylococcus aureus A9719 NCBI   amino acid ABC transporter
gi|258439632 Staphylococcus aureus A9299 NCBI   amino acid ABC transporter
gi|258442811 Staphylococcus aureus A8115 NCBI   ABC transporter
gi|258446489 Staphylococcus aureus A6300 NCBI   ABC transporter
gi|258450394 Staphylococcus aureus A6224 NCBI   ABC transporter ATP-binding protein
gi|258451283 Staphylococcus aureus A5948 NCBI   ABC transporter
gi|258455230 Staphylococcus aureus A5937 NCBI   ABC transporter
gi|259160548 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1332
gi|259163078 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0667
gi|87125978 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ABC transporter, ATP-binding protein
gi|87160004 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ABC transporter, ATP-binding protein
gi|87203895 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid ABC transporter, ATP-binding protein, putative
gi|88196337 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   amino acid ABC transporter, ATP-binding protein, putative
img|637093953 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100969 Staphylococcus aureus aureus Mu50 IMG   ABC transporter (ATP binding subunit)
img|637889000 Staphylococcus aureus aureus USA300 IMG   ABC transporter, ATP-binding protein
img|637895308 Staphylococcus aureus aureus NCTC 8325 IMG   amino acid ABC transporter, ATP-binding protein, putative
img|639109476 Staphylococcus aureus aureus JH1 IMG   ABC transporter related
img|640566822 Staphylococcus aureus aureus JH9 IMG   ABC transporter related
img|640780596 Staphylococcus aureus aureus JH1 IMG   ABC transporter related
img|640796742 Staphylococcus aureus aureus Newman IMG   amino acid ABC transporter, ATP-binding protein
img|640905194 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310397 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ABC superfamily ATP binding cassette transporter, ABC protein
img|641773042 Staphylococcus aureus aureus USA300_TCH959 IMG   ABC superfamily ATP binding cassette transporter, ABC protein
kegg|saa:SAUSA300_2357 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   ABC transporter, ATP-binding protein
kegg|sae:NWMN_2311 Staphylococcus aureus subsp. aureus Newman KEGG   amino acid ABC transporter, ATP-binding protein
kegg|sah:SaurJH1_2485 Staphylococcus aureus subsp. aureus JH1 KEGG   ABC transporter related
kegg|saj:SaurJH9_2437 Staphylococcus aureus subsp. aureus JH9 KEGG   ABC transporter related
kegg|sao:SAOUHSC_02697 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   amino acid ABC transporter, ATP-binding protein, putative
kegg|sau:SA2200   KEGG   hypothetical protein
kegg|sav:SAV2412   KEGG   ABC transporter (ATP binding subunit)
kegg|saw:SAHV_2396 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2393 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   ABC transporter ATP-binding protein
ref|NP_372936.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   ABC transporter (ATP binding subunit)
ref|NP_375523.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2200
ref|YP_001247790.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   ABC transporter related
ref|YP_001317596.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   ABC transporter related
ref|YP_001333345.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   amino acid ABC transporter, ATP-binding protein
ref|YP_001442986.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2396
ref|YP_001576262.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   ABC transporter ATP-binding protein
ref|YP_494992.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   ABC transporter, ATP-binding protein
ref|YP_501159.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   amino acid ABC transporter, ATP-binding protein, putative
ref|ZP_03563297.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   ABC transporter ATP-binding protein
ref|ZP_03565803.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   ABC transporter ATP-binding protein
ref|ZP_04837962.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   ABC transporter, ATP-binding protein
ref|ZP_04864250.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   ABC superfamily ATP binding cassette transporter, ABC protein
ref|ZP_04868337.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   ABC superfamily ATP binding cassette transporter, ABC protein
ref|ZP_05145787.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   ABC transporter, ATP-binding protein
ref|ZP_05643731.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680575.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05685152.1 Staphylococcus aureus A9719 RefSeq   amino acid ABC transporter
ref|ZP_05690378.1 Staphylococcus aureus A9299 RefSeq   amino acid ABC transporter
ref|ZP_05691371.1 Staphylococcus aureus A8115 RefSeq   ABC transporter
ref|ZP_05694644.1 Staphylococcus aureus A6300 RefSeq   ABC transporter
ref|ZP_05698486.1 Staphylococcus aureus A6224 RefSeq   ABC transporter ATP-binding protein
ref|ZP_05699316.1 Staphylococcus aureus A5948 RefSeq   ABC transporter
ref|ZP_05703190.1 Staphylococcus aureus A5937 RefSeq   ABC transporter
tr|A5IVJ1 Staphylococcus aureus (strain JH9) TrEMBL   ABC transporter related
tr|A6QJQ1 Staphylococcus aureus (strain Newman) TrEMBL   Amino acid ABC transporter, ATP-binding protein
tr|A6U4E1 Staphylococcus aureus (strain JH1) TrEMBL   ABC transporter related
tr|A7X651 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z5A0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   ABC superfamily ATP binding cassette transporter, ABC protein
tr|C5MZV8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   ABC superfamily ATP binding cassette transporter, ABC protein
tr|C5Q2G8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   ABC superfamily ATP binding cassette transporter, ABC protein
tr|Q2FE86 Staphylococcus aureus (strain USA300) TrEMBL   ABC transporter, ATP-binding protein
tr|Q2FVL4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Amino acid ABC transporter, ATP-binding protein, putative
tr|Q7A3S6 Staphylococcus aureus (strain N315) TrEMBL   SA2200 protein
tr|Q99RL8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   ABC transporter (ATP binding subunit)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
32 fig|426430.8.peg.2514 amino acid ABC transporter, permease protein
21 fig|426430.8.peg.2515 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search