The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2512: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FmhA protein of FemAB family
Translate Function Assignments



Context on contig NC_009641 from base 2532250 to 2543271 (11022 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2505 2532432 2532250 183 -           FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 2   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417
2516 2542050 2540713 1338 - 120         FIG01107989: hypothetical protein locus|NWMN_2314, protein_id|YP_001333348.1, gi|151222526, geneID|5331418
2517 2542174 2542037 138 - -14         hypothetical protein  
2518 2542327 2542431 105 + 152         hypothetical protein  
2519 2543271 2542585 687 - 153     2: 3 1   Phosphoglycerate mutase (EC 5.4.2.11) gene_name|gpmA, locus|NWMN_2315, protein_id|YP_001333349.1, gi|151222527, geneID|5331419

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2512 FmhA protein of FemAB family
MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
NFYGITGDFSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR

MD5 = d9ceef375fbfb7fe9252fa63ed890429


  DNA Sequence

>fig|426430.8.peg.2512 FmhA protein of FemAB family
atgaactttgtaacgttgacttcggatgagttcaatgcgtttacaacaaagcatttttca
cattacacacaatcagctattcattacaatcatagagttgatttaaaaggcgatgtgcat
cttgtaggggttaaagatgacaatggtcaagtgattgcaggatgcttattgacagaagca
cgcacacttaaatttttcaaatatttttatacacatcgcgggccagtgatggattataca
aatcaatcattagtagcatttttctttaaagcattaacgtcatatttaaagaaacacaat
tgtttatatgtccttgtagatccatatttaattgaaaatttacgcaatgcagacggtgaa
attgttaaatcttatgataaccgagcatttgttagaacaatggataaattaggttataaa
caccaaggtttccctgtaggttatgattcaatgagccaaatccgttggctgtcagtgtta
gatttaaaagataagactgaagaccaacttttaaaagaaatggattatcaaacgagacgt
aatattaaaaaaacatatgatattggtgtcaaaactaaaacgttaacgattgatgaaacg
caaacttttttcgacttattccatatggctgaggaaaagcacggtttcaaattccgtgag
ttaccatactttgaagaaatgcaaaagttatacgatgaccacgccatgttaaagttggcg
tatattgatttaaacgagtatttaaaaacgttacaattaaagcaacaacaattaacagct
gaactctcaggtgttgaagaagcattggaagaaagtcctaattcaaagaaaaataaaacg
aaacgcacacagctagaacaacagctaaatagcaataagcgtaaaatcgacaatacaata
gaacaaattgaacaagatggtgcagtcttaaacttagcttctgctttatttatctacaat
gagcatgaagtttattacttatctagtggttcaaaccctaaatataatgcttatatgggt
gcctaccatttgcagtgggaaatgattaagtttgctaaagcgcatcatattgatcgctat
aatttttatggtattaccggtgacttttcagagtcatcagaagactatggcgtccaacaa
ttcaaaaaaggttttaacgcacatgtagaagagtatatcggtgactttattaagcctatc
aaaccattactatataaggtacaaacgtacttaaatcataaacgtcgttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2512 FmhA protein of FemAB family
cacttcatcatcattactcaaaggtttataagctaaaatgataattttatccttatcata
gacataaatattagcatctttgcgttcaaaatgatcaacacgatcaccgttgcctttttt
ggcaagttgttcttgtttttgattttgaattttaactgcttcatctatttctttcacata
tttatcattaccacatcctgatataaagactagtaataataataccgtcgccacaaatcg
cttcaatgctcccactcctactatcaacttccaactaactttcaatataattaatactat
acaccgtcaaacattaatgcgctacaactactaccaatgcatttaatataaatatccaaa
gaaataacagttatgtatagtcaaagaaaaatatatttcattttctatgtgtatttgtaa
tcagtttttgataaaataaaaaaatagcattattaataaattcaaaaattatagttcaat
tcagagagggatgggataaaatgaactttgtaacgttgacttcggatgagttcaatgcgt
ttacaacaaagcatttttcacattacacacaatcagctattcattacaatcatagagttg
atttaaaaggcgatgtgcatcttgtaggggttaaagatgacaatggtcaagtgattgcag
gatgcttattgacagaagcacgcacacttaaatttttcaaatatttttatacacatcgcg
ggccagtgatggattatacaaatcaatcattagtagcatttttctttaaagcattaacgt
catatttaaagaaacacaattgtttatatgtccttgtagatccatatttaattgaaaatt
tacgcaatgcagacggtgaaattgttaaatcttatgataaccgagcatttgttagaacaa
tggataaattaggttataaacaccaaggtttccctgtaggttatgattcaatgagccaaa
tccgttggctgtcagtgttagatttaaaagataagactgaagaccaacttttaaaagaaa
tggattatcaaacgagacgtaatattaaaaaaacatatgatattggtgtcaaaactaaaa
cgttaacgattgatgaaacgcaaacttttttcgacttattccatatggctgaggaaaagc
acggtttcaaattccgtgagttaccatactttgaagaaatgcaaaagttatacgatgacc
acgccatgttaaagttggcgtatattgatttaaacgagtatttaaaaacgttacaattaa
agcaacaacaattaacagctgaactctcaggtgttgaagaagcattggaagaaagtccta
attcaaagaaaaataaaacgaaacgcacacagctagaacaacagctaaatagcaataagc
gtaaaatcgacaatacaatagaacaaattgaacaagatggtgcagtcttaaacttagctt
ctgctttatttatctacaatgagcatgaagtttattacttatctagtggttcaaacccta
aatataatgcttatatgggtgcctaccatttgcagtgggaaatgattaagtttgctaaag
cgcatcatattgatcgctataatttttatggtattaccggtgacttttcagagtcatcag
aagactatggcgtccaacaattcaaaaaaggttttaacgcacatgtagaagagtatatcg
gtgactttattaagcctatcaaaccattactatataaggtacaaacgtacttaaatcata
aacgtcgttaaaatatcgctccaagattatgacaacataacaaagaaccacgcatcatgt
atatggcttcatcgccatactaaaacatgatacgtggttctatttgattattcttcattt
ataacatttaagaaacgtcttaattcttctgttttcggacgattgaacatctcttctgga
gccccttgttctccgatcatgccttcatgaataaatacaatgttattagatacttcttta
gcaaaacgcatttcatgtgtcacaatgaccattgtcatgccttcattagccaaatcttta
ataacctttaaaacatcattcacaagttcaggatcaagtgcagatgttggttcatcaaac
aacatcactttagggttcattgctagtgctcttgcaatagcaacacgttgttgttgacca
cctgataatgcatgtggacgttgatctttgacatgtgttaaaccaactttctcaagtaac
tcaagtgatttcccacgtgcctcatcctttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000166       F:nucleotide binding
GO:0009252       P:peptidoglycan biosynthetic process
cmr|NT03SA2512 Staphylococcus aureus MW2     fmhA protein
cmr|NT05SA2431 Staphylococcus aureus NCTC 8325     aminoacyltransferase FemA
cmr|NT09SA2312 Staphylococcus aureus subsp. aureus MSSA476     FemAB family protein
cmr|SACOL2409 Staphylococcus aureus subsp. aureus COL     fmhA protein
cmr|SAUSA300_2356 Staphylococcus aureus subsp. aureus USA300-FPR3757     fmhA protein
dbj|BAB96198.1 Staphylococcus aureus subsp. aureus MW2     fmhA protein
dbj|BAF68582.1 Staphylococcus aureus subsp. aureus str. Newman     methicillin resistance determinant fmhA protein
emb|CAG44115.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   FemAB family protein
fig|196620.1.peg.2333 Staphylococcus aureus subsp. aureus MW2 FIG   FmhA protein of FemAB family
fig|196620.5.peg.2410 Staphylococcus aureus subsp. aureus MW2 FIG   FmhA protein of FemAB family
fig|282459.1.peg.2280 Staphylococcus aureus subsp. aureus MSSA476 FIG   FmhA protein of FemAB family
fig|282459.5.peg.2394 Staphylococcus aureus subsp. aureus MSSA476 FIG   FmhA protein of FemAB family
fig|367830.3.peg.587 Staphylococcus aureus subsp. aureus USA300 FIG   FmhA protein of FemAB family
fig|426430.6.peg.2237 Staphylococcus aureus subsp. aureus str. Newman FIG   FmhA protein of FemAB family
fig|450394.6.peg.2195 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FmhA protein of FemAB family
fig|451515.3.peg.2514 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FmhA protein of FemAB family
fig|451516.9.peg.2503 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FmhA protein of FemAB family
fig|452948.4.peg.542 Staphylococcus aureus 930918-3 FIG   FmhA protein of FemAB family
fig|455227.3.peg.799 Staphylococcus aureus D30 FIG   FmhA protein of FemAB family
fig|546342.3.peg.1517 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FmhA protein of FemAB family
fig|546343.3.peg.1341 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FmhA protein of FemAB family
fig|548475.3.peg.1756 Staphylococcus aureus subsp. aureus TCH70 FIG   FmhA protein of FemAB family
fig|553567.3.peg.770 Staphylococcus aureus A5948 FIG   FmhA protein of FemAB family
fig|553590.4.peg.1017 Staphylococcus aureus A9754 FIG   FmhA protein of FemAB family
fig|553594.3.peg.368 Staphylococcus aureus A9765 FIG   FmhA protein of FemAB family
fig|644279.4.peg.2554 Staphylococcus aureus subsp. aureus 132 FIG   FmhA protein of FemAB family
fig|762962.3.peg.2097 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FmhA protein of FemAB family
fig|93061.3.peg.2550 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FmhA protein of FemAB family
fig|93061.5.peg.2442 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FmhA protein of FemAB family
fig|93062.19.peg.2352 Staphylococcus aureus subsp. aureus COL FIG   FmhA protein of FemAB family
fig|93062.4.peg.2466 Staphylococcus aureus subsp. aureus COL FIG   FmhA protein of FemAB family
gb|AAW37234.1 Staphylococcus aureus subsp. aureus COL     fmhA protein
gb|ABD21500.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     fmhA protein
gb|ABD31704.1 Staphylococcus aureus subsp. aureus NCTC 8325     fmhA protein, putative
gb|ABX30382.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     FemAB family peptidoglycan biosynthesis protein
gb|EES55993.1 Staphylococcus aureus subsp. aureus TCH70     lysostaphin endopeptidase resistance protein
gb|EES94900.1 Staphylococcus aureus subsp. aureus USA300_TCH959     lysostaphin endopeptidase resistance protein
gb|EEV83891.1 Staphylococcus aureus A5948     fmhA protein
gb|EEW45532.1 Staphylococcus aureus 930918-3     fmhA protein
gb|EEW47638.1 Staphylococcus aureus D30     fmhA protein
gi|150375322 Staphylococcus aureus subsp. aureus str. Newman NCBI   methicillin resistance determinant fmhA protein
gi|151222522 Staphylococcus aureus subsp. aureus str. Newman NCBI   methicillin resistance determinant fmhA protein
gi|160369411 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   FemAB family peptidoglycan biosynthesis protein
gi|161510602 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   FemAB family peptidoglycan biosynthesis protein
gi|21205505 Staphylococcus aureus subsp. aureus MW2 NCBI   fmhA protein
gi|21284062 Staphylococcus aureus subsp. aureus MW2 NCBI   fmhA protein
gi|221138494 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   FemAB family peptidoglycan biosynthesis protein
gi|221141311 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   FemAB family peptidoglycan biosynthesis protein
gi|251803336 Staphylococcus aureus subsp. aureus TCH70 NCBI   lysostaphin endopeptidase resistance protein
gi|251813153 Staphylococcus aureus subsp. aureus TCH70 NCBI   lysostaphin endopeptidase resistance protein
gi|253726171 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   lysostaphin endopeptidase resistance protein
gi|253730084 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   lysostaphin endopeptidase resistance protein
gi|257861076 Staphylococcus aureus A5948 NCBI   fmhA protein
gi|258451284 Staphylococcus aureus A5948 NCBI   fmhA protein
gi|259160509 Staphylococcus aureus 930918-3 NCBI   fmhA protein
gi|259163077 Staphylococcus aureus D30 NCBI   fmhA protein
gi|49245636 Staphylococcus aureus subsp. aureus MSSA476 NCBI   FemAB family protein
gi|49487193 Staphylococcus aureus subsp. aureus MSSA476 NCBI   FemAB family protein
gi|57285140 Staphylococcus aureus subsp. aureus COL NCBI   fmhA protein
gi|57650954 Staphylococcus aureus subsp. aureus COL NCBI   fmhA protein
gi|87126986 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   fmhA protein
gi|87161012 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   fmhA protein
gi|87203894 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   fmhA protein, putative
gi|88196336 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   fmhA protein, putative
img|637153165 Staphylococcus aureus aureus COL IMG   fmhA protein
img|637158571 Staphylococcus aureus aureus MSSA476 IMG   FemAB family protein
img|637300150 Staphylococcus aureus aureus MW2 IMG   fmhA protein
img|637888999 Staphylococcus aureus aureus USA300 IMG   fmhA protein
img|637895307 Staphylococcus aureus aureus NCTC 8325 IMG   fmhA protein, putative
img|640796741 Staphylococcus aureus aureus Newman IMG   methicillin resistance determinant fmhA protein
img|641310396 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   FemAB family peptidoglycan biosynthesis protein
img|641773043 Staphylococcus aureus aureus USA300_TCH959 IMG   FemAB family peptidoglycan biosynthesis protein
kegg|saa:SAUSA300_2356 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   FmhA protein
kegg|sac:SACOL2409 Staphylococcus aureus subsp. aureus COL KEGG   FmhA protein
kegg|sae:NWMN_2310 Staphylococcus aureus subsp. aureus Newman KEGG   methicillin resistance determinant FmhA protein
kegg|sam:MW2333 Staphylococcus aureus subsp. aureus MW2 KEGG   FmhA protein
kegg|sao:SAOUHSC_02696 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   FmhA protein, putative
kegg|sas:SAS2302   KEGG   FemAB family protein
kegg|sax:USA300HOU_2392 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   FemAB family peptidoglycan biosynthesis protein
ref|NP_647150.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   fmhA protein
ref|YP_001333344.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   methicillin resistance determinant fmhA protein
ref|YP_001576261.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   FemAB family peptidoglycan biosynthesis protein
ref|YP_044414.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   FemAB family protein
ref|YP_187212.1 Staphylococcus aureus subsp. aureus COL RefSeq   fmhA protein
ref|YP_494991.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   fmhA protein
ref|YP_501158.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   fmhA protein, putative
ref|ZP_03563296.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   FemAB family peptidoglycan biosynthesis protein
ref|ZP_03565804.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   FemAB family peptidoglycan biosynthesis protein
ref|ZP_04827626.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   lysostaphin endopeptidase resistance protein
ref|ZP_04864249.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   lysostaphin endopeptidase resistance protein
ref|ZP_05699317.1 Staphylococcus aureus A5948 RefSeq   fmhA protein
tr|A6QJQ0 Staphylococcus aureus (strain Newman) TrEMBL   Methicillin resistance determinant fmhA protein
tr|A8Z599 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   FemAB family peptidoglycan biosynthesis protein
tr|C5MZV7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Lysostaphin endopeptidase resistance protein
tr|C5QFR0 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Lysostaphin endopeptidase resistance protein
tr|Q2FE87 Staphylococcus aureus (strain USA300) TrEMBL   FmhA protein
tr|Q2FVL5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   FmhA protein, putative
tr|Q5HDE5 Staphylococcus aureus (strain COL) TrEMBL   FmhA protein
tr|Q6G6R0 Staphylococcus aureus (strain MSSA476) TrEMBL   FemAB family protein
tr|Q8NV14 Staphylococcus aureus (strain MW2) TrEMBL   FmhA protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search