The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2511: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108076: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 2531209 to 2542050 (10842 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2504 2532033 2531209 825 -           formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 1   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417
2516 2542050 2540713 1338 - 120         FIG01107989: hypothetical protein locus|NWMN_2314, protein_id|YP_001333348.1, gi|151222526, geneID|5331418

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2511 FIG01108076: hypothetical protein
MKRFVATVLLLLVFISGCGNDKYVKEIDEAVKIQNQKQEQLAKKGNGDRVDHFERKDANI
YVYDKDKIIILAYKPLSNDDEVHYYAYDFSDKRVSYKQDFDSRRYYQQHDADYHEENMTN

MD5 = 4a4c393c9c416b05751ce6622852d82c


  DNA Sequence

>fig|426430.8.peg.2511 FIG01108076: hypothetical protein
ttgaagcgatttgtggcgacggtattattattactagtctttatatcaggatgtggtaat
gataaatatgtgaaagaaatagatgaagcagttaaaattcaaaatcaaaaacaagaacaa
cttgccaaaaaaggcaacggtgatcgtgttgatcattttgaacgcaaagatgctaatatt
tatgtctatgataaggataaaattatcattttagcttataaacctttgagtaatgatgat
gaagtgcattattatgcatatgattttagtgataaacgtgtatcatataagcaagatttt
gattcgagacgatattatcaacaacatgatgcggattatcatgaagaaaatatgacgaac
tag


  DNA with Flanking Sequence

>fig|426430.8.peg.2511 FIG01108076: hypothetical protein
ttgatttgtataatccatcactggcccgcgatgtgtataaaaatatttgaaaaatttaag
tgtgcgtgcttctgtcaataagcatcctgcaatcacttgaccattgtcatctttaacccc
tacaagatgcacatcgccttttaaatcaactctatgattgtaatgaatagctgattgtgt
gtaatgtgaaaaatgctttgttgtaaacgcattgaactcatccgaagtcaacgttacaaa
gttcattttatcccatccctctctgaattgaactataatttttgaatttattaataatgc
tatttttttattttatcaaaaactgattacaaatacacatagaaaatgaaatatattttt
ctttgactatacataactgttatttctttggatatttatattaaatgcattggtagtagt
tgtagcgcattaatgtttgacggtgtatagtattaattatattgaaagttagttggaagt
tgatagtaggagtgggagcattgaagcgatttgtggcgacggtattattattactagtct
ttatatcaggatgtggtaatgataaatatgtgaaagaaatagatgaagcagttaaaattc
aaaatcaaaaacaagaacaacttgccaaaaaaggcaacggtgatcgtgttgatcattttg
aacgcaaagatgctaatatttatgtctatgataaggataaaattatcattttagcttata
aacctttgagtaatgatgatgaagtgcattattatgcatatgattttagtgataaacgtg
tatcatataagcaagattttgattcgagacgatattatcaacaacatgatgcggattatc
atgaagaaaatatgacgaactagatatgaataggagttattatgactaaaaaattactaa
cattatttatagtgagcatgttaattttaacagcttgcggtaaaaaagaatcagcaacga
catcttcgaaaaacggcaaaccattagttgtcgtatatggcgactataaatgtccttatt
gtaaagaattagatgaaaaagtcatgccaaagttgcgtaaaaattatatagataatcaca
aagtggaataccaatttgtcaatttagctttcttaggtaaagactcaattgttggttcgc
gtgcgagtcatgcagtattgatgtatgcacctaaatcatttttagattttcaaaagcaat
tatttgctgcccagcaagatgaaaataaagaatggttaacaaaagaactattagataaac
atattaaacaactgcatttagataaagagacggaaaataaaattataaaagattacaaga
caaaagatagcaagtcttggaaagctgcagagaaagataaaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2430 Staphylococcus aureus NCTC 8325     lipoprotein, putative
cmr|NT11SA2291 Staphylococcus aureus RF122     conserved hypothetical protein
dbj|BAB43500.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB58572.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB96197.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF79277.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG41480.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative lipoprotein
emb|CAG44114.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative lipoprotein
emb|CAI81979.1 Staphylococcus aureus RF122 EMBL   probable lipoprotein
fig|158878.1.peg.2410 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108076: hypothetical protein
fig|158878.14.peg.2494 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108076: hypothetical protein
fig|158879.1.peg.2283 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108076: hypothetical protein
fig|158879.11.peg.2383 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108076: hypothetical protein
fig|196620.1.peg.2332 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108076: hypothetical protein
fig|196620.5.peg.2409 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108076: hypothetical protein
fig|273036.3.peg.2228 Staphylococcus aureus RF122 FIG   FIG01108076: hypothetical protein
fig|273036.6.peg.2408 Staphylococcus aureus RF122 FIG   FIG01108076: hypothetical protein
fig|282458.1.peg.2367 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01108076: hypothetical protein
fig|282458.4.peg.2523 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01108076: hypothetical protein
fig|282459.1.peg.2279 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108076: hypothetical protein
fig|282459.5.peg.2393 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108076: hypothetical protein
fig|359786.13.peg.2574 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108076: hypothetical protein
fig|359786.3.peg.1515 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108076: hypothetical protein
fig|359787.3.peg.664 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108076: hypothetical protein
fig|452948.4.peg.543 Staphylococcus aureus 930918-3 FIG   FIG01108076: hypothetical protein
fig|455227.3.peg.800 Staphylococcus aureus D30 FIG   FIG01108076: hypothetical protein
fig|505321.3.peg.196 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108076: hypothetical protein
fig|546342.3.peg.1516 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108076: hypothetical protein
fig|546343.3.peg.1342 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108076: hypothetical protein
fig|548470.3.peg.927 Staphylococcus aureus subsp. aureus MN8 FIG   FIG01108076: hypothetical protein
fig|548473.3.peg.175 Staphylococcus aureus subsp. aureus TCH60 FIG   FIG01108076: hypothetical protein
fig|548474.3.peg.468 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108076: hypothetical protein
fig|548475.3.peg.1757 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108076: hypothetical protein
fig|553565.3.peg.1992 Staphylococcus aureus A5937 FIG   FIG01108076: hypothetical protein
fig|553567.3.peg.771 Staphylococcus aureus A5948 FIG   FIG01108076: hypothetical protein
fig|553568.3.peg.2742 Staphylococcus aureus A6224 FIG   FIG01108076: hypothetical protein
fig|553571.3.peg.1515 Staphylococcus aureus A6300 FIG   FIG01108076: hypothetical protein
fig|553573.3.peg.802 Staphylococcus aureus A8115 FIG   FIG01108076: hypothetical protein
fig|553577.3.peg.239 Staphylococcus aureus A8796 FIG   FIG01108076: hypothetical protein
fig|553580.3.peg.240 Staphylococcus aureus A8819 FIG   FIG01108076: hypothetical protein
fig|553581.3.peg.2482 Staphylococcus aureus A9299 FIG   FIG01108076: hypothetical protein
fig|553588.3.peg.2572 Staphylococcus aureus A9719 FIG   FIG01108076: hypothetical protein
fig|553592.3.peg.555 Staphylococcus aureus A9763 FIG   FIG01108076: hypothetical protein
fig|553594.3.peg.367 Staphylococcus aureus A9765 FIG   FIG01108076: hypothetical protein
fig|553601.3.peg.1906 Staphylococcus aureus A10102 FIG   FIG01108076: hypothetical protein
fig|585143.3.peg.889 Staphylococcus aureus subsp. aureus 55/2053 FIG   FIG01108076: hypothetical protein
fig|585144.3.peg.879 Staphylococcus aureus subsp. aureus 58-424 FIG   FIG01108076: hypothetical protein
fig|585145.3.peg.688 Staphylococcus aureus subsp. aureus 65-1322 FIG   FIG01108076: hypothetical protein
fig|585146.3.peg.319 Staphylococcus aureus subsp. aureus 68-397 FIG   FIG01108076: hypothetical protein
fig|585147.3.peg.2041 Staphylococcus aureus subsp. aureus A017934/97 FIG   FIG01108076: hypothetical protein
fig|585148.3.peg.2199 Staphylococcus aureus subsp. aureus Btn1260 FIG   FIG01108076: hypothetical protein
fig|585149.6.peg.2592 Staphylococcus aureus subsp. aureus C101 FIG   FIG01108076: hypothetical protein
fig|585150.3.peg.810 Staphylococcus aureus subsp. aureus C160 FIG   FIG01108076: hypothetical protein
fig|585151.3.peg.2400 Staphylococcus aureus subsp. aureus C427 FIG   FIG01108076: hypothetical protein
fig|585152.3.peg.2394 Staphylococcus aureus subsp. aureus D139 FIG   FIG01108076: hypothetical protein
fig|585153.3.peg.687 Staphylococcus aureus subsp. aureus E1410 FIG   FIG01108076: hypothetical protein
fig|585154.3.peg.2480 Staphylococcus aureus subsp. aureus EMRSA16 FIG   FIG01108076: hypothetical protein
fig|585155.3.peg.952 Staphylococcus aureus subsp. aureus H19 FIG   FIG01108076: hypothetical protein
fig|585156.3.peg.2091 Staphylococcus aureus subsp. aureus M1015 FIG   FIG01108076: hypothetical protein
fig|585157.3.peg.2087 Staphylococcus aureus subsp. aureus M809 FIG   FIG01108076: hypothetical protein
fig|585158.3.peg.466 Staphylococcus aureus subsp. aureus M876 FIG   FIG01108076: hypothetical protein
fig|585160.3.peg.2230 Staphylococcus aureus subsp. aureus WBG10049 FIG   FIG01108076: hypothetical protein
fig|585891.3.peg.2488 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108076: hypothetical protein
fig|644279.4.peg.2553 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108076: hypothetical protein
fig|680649.3.peg.2556 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108076: hypothetical protein
fig|681288.4.peg.2437 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108076: hypothetical protein
fig|703339.3.peg.2398 Staphylococcus aureus 04-02981 FIG   FIG01108076: hypothetical protein
fig|762962.3.peg.2098 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108076: hypothetical protein
fig|93061.5.peg.2441 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108076: hypothetical protein
gb|AAM83193.2 Staphylococcus aureus     SA2198
gb|ABQ50212.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_2435
gb|ABR53307.1 Staphylococcus aureus subsp. aureus JH1     lipoprotein, putative
gb|EEW45570.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1331
gb|EEW47637.1 Staphylococcus aureus D30     hypothetical protein SAD30_0665
gi|13702359 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14248184 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147741914 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2435
gi|148268845 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2435
gi|149947371 Staphylococcus aureus subsp. aureus JH1 NCBI   lipoprotein, putative
gi|150394919 Staphylococcus aureus subsp. aureus JH1 NCBI   putative lipoprotein
gi|156722860 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980725 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2394
gi|15925400 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2410
gi|15927988 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2198
gi|21205504 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21284061 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2332
gi|21956648 Staphylococcus aureus NCBI   SA2198
gi|221138493 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_07583
gi|221141312 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06678
gi|253314747 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00950
gi|255007184 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_11965
gi|259160547 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1331
gi|259163076 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0665
gi|49242755 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative lipoprotein
gi|49245635 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative lipoprotein
gi|49484626 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative lipoprotein
gi|49487192 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative lipoprotein
gi|82657537 Staphylococcus aureus RF122 NCBI   probable lipoprotein
gi|82752006 Staphylococcus aureus RF122 NCBI   lipoprotein
img|637093951 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100967 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637155928 Staphylococcus aureus aureus MRSA252 IMG   putative lipoprotein
img|637158570 Staphylococcus aureus aureus MSSA476 IMG   putative lipoprotein
img|637300149 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817271 Staphylococcus aureus RF122 IMG   probable lipoprotein
img|639109478 Staphylococcus aureus aureus JH1 IMG   lipoprotein, putative
img|640566820 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640780594 Staphylococcus aureus aureus JH1 IMG   lipoprotein, putative
img|640905192 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sab:SAB2290c Staphylococcus aureus RF122 KEGG   lipoprotein
kegg|sah:SaurJH1_2483 Staphylococcus aureus subsp. aureus JH1 KEGG   putative lipoprotein
kegg|saj:SaurJH9_2435 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW2332 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sar:SAR2500   KEGG   putative lipoprotein
kegg|sas:SAS2301   KEGG   putative lipoprotein
kegg|sau:SA2198   KEGG   hypothetical protein
kegg|sav:SAV2410   KEGG   hypothetical protein
kegg|saw:SAHV_2394 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372934.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2410
ref|NP_375521.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2198
ref|NP_647149.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2332
ref|YP_001247788.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_2435
ref|YP_001317594.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   putative lipoprotein
ref|YP_001442984.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2394
ref|YP_041850.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative lipoprotein
ref|YP_044413.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative lipoprotein
ref|YP_417747.1 Staphylococcus aureus RF122 RefSeq   lipoprotein
ref|ZP_03563295.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_07583
ref|ZP_03565805.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06678
ref|ZP_04837960.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00950
ref|ZP_05145785.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_11965
tr|A5IVI9 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein precursor
tr|A6U4D9 Staphylococcus aureus (strain JH1) TrEMBL   Lipoprotein, putative precursor
tr|A7X648 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q2YW01 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Probable lipoprotein
tr|Q6G6R1 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative lipoprotein
tr|Q6GE23 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative lipoprotein
tr|Q7A022 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2332
tr|Q7A2L6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein
tr|Q7A3S8 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA2198
tr|Q99RL9 Staphylococcus aureus TrEMBL   SA2198 precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search