The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2509: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Antitoxin DinJ (binds YafQ toxin)
Translate Function Assignments



Context on contig NC_009641 from base 2530440 to 2540592 (10153 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2503 2530976 2530440 537 -           Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294 24     FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74       Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 1   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2509 Antitoxin DinJ (binds YafQ toxin)
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
AEHLAQSIADLERGKTITKDIDV

MD5 = db64600757e60a56c912b7254579626f


  DNA Sequence

>fig|426430.8.peg.2509 Antitoxin DinJ (binds YafQ toxin)
atgattattaaaaattattcatacgctcgacagaatttaaaggcacttatgacaaaagta
aatgatgatagtgatatggtaactgtaacatctactgatgataaaaacgtagtaatcatg
tcagaatcagattataactccatgatggaaacactttacctccaacagaacccaaataat
gctgaacacttagctcaatcaattgcagatctagaacgtgggaaaactataacgaaagat
atagatgtataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2509 Antitoxin DinJ (binds YafQ toxin)
gataaacatattaaacaactgcatttagataaagagacggaaaataaaattataaaagat
tacaagacaaaagatagcaagtcttggaaagctgcagagaaagataaaaaaatagcgaaa
gataatcatataaaaacgacaccaactgcatttattaatggcgagaaagttgaagatcca
tatgattatgaaagttatgagaagttattaaaagataaaatcaaatagtcttaattgttg
agatcagtaagtgataccaatttattaggacaatacgaaaaggcaatttctattagcgat
atgatagagattgtctttttaatgtatgaagtctaaataggtggaaattatcatgtaaac
attgtttagtagggaatcagtacaggataggtattgattcttccccgtgcgaaatcttga
ttagtagtttttttctgtgtcgcttgttttattgtacagatatttgtacaattgaggtgt
gttaaaagagggcgataaatatgattattaaaaattattcatacgctcgacagaatttaa
aggcacttatgacaaaagtaaatgatgatagtgatatggtaactgtaacatctactgatg
ataaaaacgtagtaatcatgtcagaatcagattataactccatgatggaaacactttacc
tccaacagaacccaaataatgctgaacacttagctcaatcaattgcagatctagaacgtg
ggaaaactataacgaaagatatagatgtataatggctaggttaaatattacgttttcgcc
tcaagcctttgaagattataagtattttcagcagaacgataaaaaaatggtgaagaagat
taatgagttacttaaaagtattgacagaaatggtgcattggaaggtataggtaagcctga
aaagttaaaatcgaatctgactgggtattatagtagacgtatcaatcacgaacatagatt
ggtttatacagtagatgacaatcatataaaaatagcatcatgtaaataccattattaaat
ctaaaagtcacactataaaaatagggtaagttattttaggacaatatgaaaaggcaattt
ctattagcaatatgatagagattgtctttttttcttatattatgacgttcgtaaatacta
taaagttttctgtatcatatttgtacaatagtcatgtattagataaaacgaaaagtggta
aatacctaaagtatgattcgactttatattatttataaaaacagtgcttgta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA2422 Staphylococcus aureus N315     Uncharacterized ACR, COG2161 subfamily
cmr|NT02SA2405 Staphylococcus aureus Mu50     yefM protein
cmr|NT03SA2509 Staphylococcus aureus MW2     Uncharacterized ACR, COG2161 subfamily
cmr|NT05SA2428 Staphylococcus aureus NCTC 8325     prevent-host-death protein
cmr|NT09SA2309 Staphylococcus aureus subsp. aureus MSSA476     DUF172
cmr|NT11SA2289 Staphylococcus aureus RF122     addiction module antitoxin, Axe family
cmr|SACOL2405 Staphylococcus aureus subsp. aureus COL     addiction module antitoxin, Axe family
dbj|BAB43498.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB58570.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB96195.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF79275.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG44112.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
emb|CAI81977.1 Staphylococcus aureus RF122 EMBL   hypothetical protein
fig|158878.1.peg.2408 Staphylococcus aureus subsp. aureus Mu50 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|158878.14.peg.2492 Staphylococcus aureus subsp. aureus Mu50 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|158879.1.peg.2281 Staphylococcus aureus subsp. aureus N315 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|158879.11.peg.2381 Staphylococcus aureus subsp. aureus N315 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|196620.1.peg.2330 Staphylococcus aureus subsp. aureus MW2 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|196620.5.peg.2407 Staphylococcus aureus subsp. aureus MW2 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|273036.3.peg.2226 Staphylococcus aureus RF122 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|273036.6.peg.2406 Staphylococcus aureus RF122 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|282459.1.peg.2277 Staphylococcus aureus subsp. aureus MSSA476 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|282459.5.peg.2391 Staphylococcus aureus subsp. aureus MSSA476 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|359786.13.peg.2572 Staphylococcus aureus subsp. aureus JH9 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|359786.3.peg.1517 Staphylococcus aureus subsp. aureus JH9 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|359787.11.peg.2535 Staphylococcus aureus subsp. aureus JH1 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|359787.3.peg.666 Staphylococcus aureus subsp. aureus JH1 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|418127.6.peg.2455 Staphylococcus aureus subsp. aureus Mu3 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|450394.6.peg.2192 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|452948.4.peg.545 Staphylococcus aureus 930918-3 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|455227.3.peg.802 Staphylococcus aureus D30 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|505321.3.peg.194 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Antitoxin DinJ (binds YafQ toxin)
fig|546342.3.peg.1514 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|546343.3.peg.1344 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|548474.3.peg.470 Staphylococcus aureus subsp. aureus TCH130 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|548475.3.peg.1759 Staphylococcus aureus subsp. aureus TCH70 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553565.3.peg.1994 Staphylococcus aureus A5937 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553567.3.peg.773 Staphylococcus aureus A5948 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553568.3.peg.2740 Staphylococcus aureus A6224 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553571.3.peg.1517 Staphylococcus aureus A6300 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553573.3.peg.800 Staphylococcus aureus A8115 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553574.3.peg.1197 Staphylococcus aureus A8117 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553577.3.peg.237 Staphylococcus aureus A8796 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553580.3.peg.238 Staphylococcus aureus A8819 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553581.3.peg.2484 Staphylococcus aureus A9299 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553588.3.peg.2574 Staphylococcus aureus A9719 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553592.3.peg.553 Staphylococcus aureus A9763 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553594.3.peg.365 Staphylococcus aureus A9765 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553596.3.peg.1656 Staphylococcus aureus A9781 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|553601.3.peg.1904 Staphylococcus aureus A10102 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|585891.3.peg.2486 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Antitoxin DinJ (binds YafQ toxin)
fig|644279.4.peg.2551 Staphylococcus aureus subsp. aureus 132 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|680649.3.peg.2662 Staphylococcus aureus subsp. aureus MR1 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|681288.4.peg.2435 Staphylococcus aureus subsp. aureus ED98 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|703339.3.peg.2396 Staphylococcus aureus 04-02981 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|762962.3.peg.2100 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|93061.3.peg.2546 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|93061.5.peg.2439 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Antitoxin DinJ (binds YafQ toxin)
fig|93062.19.peg.2349 Staphylococcus aureus subsp. aureus COL FIG   Antitoxin DinJ (binds YafQ toxin)
fig|93062.4.peg.2463 Staphylococcus aureus subsp. aureus COL FIG   Antitoxin DinJ (binds YafQ toxin)
gb|AAW37230.1 Staphylococcus aureus subsp. aureus COL     addiction module antitoxin, Axe family
gb|ABD31700.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50210.1 Staphylococcus aureus subsp. aureus JH9     prevent-host-death family protein
gb|ABR53305.1 Staphylococcus aureus subsp. aureus JH1     prevent-host-death family protein
gb|EES55996.1 Staphylococcus aureus subsp. aureus TCH70     prevent-host-death protein
gb|EES94897.1 Staphylococcus aureus subsp. aureus USA300_TCH959     prevent-host-death protein
gb|EES96600.1 Staphylococcus aureus subsp. aureus TCH130     prevent-host-death protein
gb|EEV27060.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65391.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66112.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71414.1 Staphylococcus aureus A9299     prevent-host-death family protein
gb|EEV75862.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77509.1 Staphylococcus aureus A6300     prevent-host-death family protein
gb|EEV79391.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83894.1 Staphylococcus aureus A5948     prevent-host-death family protein
gb|EEV85213.1 Staphylococcus aureus A5937     addiction module antitoxin
gb|EEW45568.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1329
gb|EEW47635.1 Staphylococcus aureus D30     hypothetical protein SAD30_0663
gi|13702357 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14248182 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147741912 Staphylococcus aureus subsp. aureus JH9 NCBI   prevent-host-death family protein
gi|148268843 Staphylococcus aureus subsp. aureus JH9 NCBI   prevent-host-death family protein
gi|149947369 Staphylococcus aureus subsp. aureus JH1 NCBI   prevent-host-death family protein
gi|150394917 Staphylococcus aureus subsp. aureus JH1 NCBI   prevent-host-death family protein
gi|156722858 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156980723 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2392
gi|15925398 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2408
gi|15927986 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2196
gi|21205502 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21284059 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2330
gi|221138491 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_07573
gi|221141314 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06688
gi|251803339 Staphylococcus aureus subsp. aureus TCH70 NCBI   prevent-host-death protein
gi|251813156 Staphylococcus aureus subsp. aureus TCH70 NCBI   prevent-host-death protein
gi|253314745 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00940
gi|253726168 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   prevent-host-death protein
gi|253727871 Staphylococcus aureus subsp. aureus TCH130 NCBI   prevent-host-death protein
gi|253730081 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   prevent-host-death protein
gi|253734176 Staphylococcus aureus subsp. aureus TCH130 NCBI   prevent-host-death protein
gi|255007182 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_11955
gi|257788720 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794748 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840940 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257841675 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847412 Staphylococcus aureus A9299 NCBI   prevent-host-death family protein
gi|257851928 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854561 Staphylococcus aureus A6300 NCBI   prevent-host-death family protein
gi|257856482 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257861079 Staphylococcus aureus A5948 NCBI   prevent-host-death family protein
gi|257862445 Staphylococcus aureus A5937 NCBI   addiction module antitoxin
gi|258407428 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258422244 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258439636 Staphylococcus aureus A9299 NCBI   prevent-host-death family protein
gi|258442807 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446493 Staphylococcus aureus A6300 NCBI   prevent-host-death family protein
gi|258450390 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451287 Staphylococcus aureus A5948 NCBI   prevent-host-death family protein
gi|258455234 Staphylococcus aureus A5937 NCBI   addiction module antitoxin
gi|259160545 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1329
gi|259163074 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0663
gi|49245633 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49487190 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2299
gi|57285136 Staphylococcus aureus subsp. aureus COL NCBI   addiction module antitoxin, Axe family
gi|57650950 Staphylococcus aureus subsp. aureus COL NCBI   addiction module antitoxin
gi|82657535 Staphylococcus aureus RF122 NCBI   hypothetical protein
gi|82752004 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB2288c
gi|87203890 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196332 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02692
img|637093949 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100965 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637153161 Staphylococcus aureus aureus COL IMG   addiction module antitoxin, Axe family
img|637158568 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300147 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817269 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637895303 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109480 Staphylococcus aureus aureus JH1 IMG   Prevent-host-death protein
img|640566818 Staphylococcus aureus aureus JH9 IMG   prevent-host-death family protein
img|640780592 Staphylococcus aureus aureus JH1 IMG   prevent-host-death family protein
img|640905190 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641773047 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|sab:SAB2288c Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL2405 Staphylococcus aureus subsp. aureus COL KEGG   addiction module antitoxin
kegg|sah:SaurJH1_2481 Staphylococcus aureus subsp. aureus JH1 KEGG   prevent-host-death family protein
kegg|saj:SaurJH9_2433 Staphylococcus aureus subsp. aureus JH9 KEGG   prevent-host-death family protein
kegg|sam:MW2330 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02692 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2299   KEGG   hypothetical protein
kegg|sau:SA2196   KEGG   hypothetical protein
kegg|sav:SAV2408   KEGG   hypothetical protein
kegg|saw:SAHV_2392 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372932.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2408
ref|NP_375519.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2196
ref|NP_647147.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2330
ref|YP_001247786.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   prevent-host-death family protein
ref|YP_001317592.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   prevent-host-death family protein
ref|YP_001442982.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2392
ref|YP_044411.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2299
ref|YP_187208.1 Staphylococcus aureus subsp. aureus COL RefSeq   addiction module antitoxin
ref|YP_417745.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB2288c
ref|YP_501154.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02692
ref|ZP_03563293.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_07573
ref|ZP_03565807.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06688
ref|ZP_04827629.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   prevent-host-death protein
ref|ZP_04837958.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00940
ref|ZP_04864246.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   prevent-host-death protein
ref|ZP_04868341.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   prevent-host-death protein
ref|ZP_05145783.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_11955
ref|ZP_05643727.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680571.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05685156.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690382.1 Staphylococcus aureus A9299 RefSeq   prevent-host-death family protein
ref|ZP_05691367.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694648.1 Staphylococcus aureus A6300 RefSeq   prevent-host-death family protein
ref|ZP_05698482.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699320.1 Staphylococcus aureus A5948 RefSeq   prevent-host-death family protein
ref|ZP_05703194.1 Staphylococcus aureus A5937 RefSeq   addiction module antitoxin
tr|A5IVI7 Staphylococcus aureus (strain JH9) TrEMBL   Prevent-host-death family protein
tr|A6U4D7 Staphylococcus aureus (strain JH1) TrEMBL   Prevent-host-death family protein
tr|A7X645 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C5MZV4 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Prevent-host-death protein
tr|C5Q2H2 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Prevent-host-death protein
tr|C5QFR3 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Prevent-host-death protein
tr|Q2G285 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YW03 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HDE9 Staphylococcus aureus (strain COL) TrEMBL   Addiction module antitoxin, Axe family
tr|Q6G6R3 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q7A024 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2330
tr|Q7A3T0 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA2196
tr|Q99RM1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
24 fig|426430.8.peg.2508 FIG01108752: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search