The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2507: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Candidate zinc-binding lipoprotein ZinT
Translate Function Assignments



Context on contig NC_009641 from base 2527008 to 2539832 (12825 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2501 2529413 2527008 2406 -       3: 5 4 2   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65     1: 1   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 3   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2507 Candidate zinc-binding lipoprotein ZinT
MKKKLGMLLLVPAVTLSLAACGNDDGKDKDGKVTIKTTVYPLQSFAEQIGGKHVKVSSIY
PAGTDLHSYEPTQKDILSASKSDLFMYTGDNLDPVAKKVASTIKDKDKKLSLEDKLDKAK
LLTDQHEHGEEHEHEGHDHEKEEHHHHHGGYDPHVWLDPKINQTFAKEIKDELVKKDPKH
KDDYEKNYKKLNDDLKKIDNDMKQVTKDKQGNAVFISHESIGYLADCYGFVQKGIQNMNA
EDPSQKELTKIVKEIRDSNAKYILYEDNVANKVTETIRKETDAKPLKFYNMESLNKEQQK
KDNITYQSLMKSNIENIGKALDSGVKVKDDKAESKHDKAISDGYFKDEQVKDRELSDYAG
EWQSVYPYLKDGTLDEVMEHKAENDPKKSAKDLKAYYDKGYKTDITNIDIKGNEITFTKD
GKKHTGKYEYNGKKTLKYPKGNRGVRFMFKLVDGNDKDLPKFIQFSDHHIAPKKAEHFHI
FMGNDNDALLKRMDYWPTYYPSKLNKDPIKEEMLAHYFNRFAHSTQLLIAE

MD5 = f586c67dfbd74aef503d42db1ad4fa76


  DNA Sequence

>fig|426430.8.peg.2507 Candidate zinc-binding lipoprotein ZinT
atgaaaaagaaattaggtatgttacttcttgtaccagccgtaactttatcattagccgca
tgtgggaatgatgatggaaaagataaagatggcaaggtaacaattaaaacgacagtttat
ccattgcaatcatttgcagagcaaattggtggaaaacacgtgaaggtatcatcaatctat
ccagcagggacagatttacatagctatgaaccaacacaaaaagatatattaagtgcaagc
aagtcagacttgtttatgtatacaggggataatttagatccggttgctaagaaagttgca
tctactatcaaagataaagataaaaaactgtctttagaggataaattagataaagcaaag
cttttaactgatcaacacgagcatggtgaagagcatgaacatgagggacatgatcatgag
aaagaagaacatcatcatcatcatggtggatatgatccacacgtatggttagatcctaaa
attaaccaaactttcgctaaagaaattaaagatgaattagtgaaaaaagatccaaaacat
aaagatgactatgagaaaaactacaaaaaattaaacgacgatcttaagaaaattgataac
gatatgaagcaagttacaaaagataagcaaggtaatgcagtattcatttcacatgaatca
attggatacttagctgattgttatggttttgttcaaaaaggtattcaaaacatgaatgct
gaagatccatcacaaaaagaattaactaaaattgttaaagaaattagagatagcaatgct
aaatatattctttacgaagataatgttgcgaataaagtgactgaaacaattcgtaaagaa
acagatgcgaagcctttaaaattctacaacatggagtctttaaataaagaacaacagaaa
aaagataatattacgtatcaatcattaatgaaatctaatattgaaaatatcggtaaagct
ttagacagtggtgttaaagtgaaagacgacaaagctgaaagtaaacatgacaaagcaatt
tctgatgggtattttaaagatgagcaagttaaagaccgtgaattaagcgattatgctggt
gaatggcaatctgtttacccttacttaaaagacggtacgcttgatgaagtgatggaacat
aaagctgaaaatgatccgaagaaatctgctaaagatttaaaagcttattatgacaaagga
tataaaactgatattactaacattgatataaaaggaaatgaaattacatttactaaagat
ggtaagaaacacactggtaaatatgaatacaatggtaagaaaacattgaaatatcctaaa
ggtaaccgtggcgtgagatttatgtttaaattggtcgatggtaatgataaagacttaccg
aaattcatccaatttagcgatcaccacattgcacctaaaaaggcagaacacttccatatc
tttatgggtaatgataatgacgcgttattaaaaagaatggattactggccaacatattat
ccttcaaaattaaataaagacccaatcaaagaagaaatgttagcgcattatttcaacagg
tttgcacactctactcaactgttaatagctgaatag


  DNA with Flanking Sequence

>fig|426430.8.peg.2507 Candidate zinc-binding lipoprotein ZinT
agaacgataaaaaaatggtgaagaagattaatgagttacttaaaagtattgacagaaatg
gtgcattggaaggtataggtaagcctgaaaagttaaaatcgaatctgactgggtattata
gtagacgtatcaatcacgaacatagattggtttatacagtagatgacaatcatataaaaa
tagcatcatgtaaataccattattaaatctaaaagtcacactataaaaatagggtaagtt
attttaggacaatatgaaaaggcaatttctattagcaatatgatagagattgtctttttt
tcttatattatgacgttcgtaaatactataaagttttctgtatcatatttgtacaatagt
catgtattagataaaacgaaaagtggtaaatacctaaagtatgattcgactttatattat
ttataaaaacagtgcttgtattttaagtagcatgagtatataattttaaaacgtaaagat
tactatttaggagggtgactatgaaaaagaaattaggtatgttacttcttgtaccagccg
taactttatcattagccgcatgtgggaatgatgatggaaaagataaagatggcaaggtaa
caattaaaacgacagtttatccattgcaatcatttgcagagcaaattggtggaaaacacg
tgaaggtatcatcaatctatccagcagggacagatttacatagctatgaaccaacacaaa
aagatatattaagtgcaagcaagtcagacttgtttatgtatacaggggataatttagatc
cggttgctaagaaagttgcatctactatcaaagataaagataaaaaactgtctttagagg
ataaattagataaagcaaagcttttaactgatcaacacgagcatggtgaagagcatgaac
atgagggacatgatcatgagaaagaagaacatcatcatcatcatggtggatatgatccac
acgtatggttagatcctaaaattaaccaaactttcgctaaagaaattaaagatgaattag
tgaaaaaagatccaaaacataaagatgactatgagaaaaactacaaaaaattaaacgacg
atcttaagaaaattgataacgatatgaagcaagttacaaaagataagcaaggtaatgcag
tattcatttcacatgaatcaattggatacttagctgattgttatggttttgttcaaaaag
gtattcaaaacatgaatgctgaagatccatcacaaaaagaattaactaaaattgttaaag
aaattagagatagcaatgctaaatatattctttacgaagataatgttgcgaataaagtga
ctgaaacaattcgtaaagaaacagatgcgaagcctttaaaattctacaacatggagtctt
taaataaagaacaacagaaaaaagataatattacgtatcaatcattaatgaaatctaata
ttgaaaatatcggtaaagctttagacagtggtgttaaagtgaaagacgacaaagctgaaa
gtaaacatgacaaagcaatttctgatgggtattttaaagatgagcaagttaaagaccgtg
aattaagcgattatgctggtgaatggcaatctgtttacccttacttaaaagacggtacgc
ttgatgaagtgatggaacataaagctgaaaatgatccgaagaaatctgctaaagatttaa
aagcttattatgacaaaggatataaaactgatattactaacattgatataaaaggaaatg
aaattacatttactaaagatggtaagaaacacactggtaaatatgaatacaatggtaaga
aaacattgaaatatcctaaaggtaaccgtggcgtgagatttatgtttaaattggtcgatg
gtaatgataaagacttaccgaaattcatccaatttagcgatcaccacattgcacctaaaa
aggcagaacacttccatatctttatgggtaatgataatgacgcgttattaaaaagaatgg
attactggccaacatattatccttcaaaattaaataaagacccaatcaaagaagaaatgt
tagcgcattatttcaacaggtttgcacactctactcaactgttaatagctgaatagagtg
tgttttttatttcgtagttatcaatttcaacagagggaatgattaatattactatagttt
atacaaatgatttggtaacatatgttactcaatgcatgttaagatgagtaaatataaaag
atagggagtgggaagatgacgattaaagttgaagataataaaattattttttcaagaacg
atagaagcaccgattgaaaaggtgtttgatgcctatacgacaaaagcattatttgaaaaa
tggtttcatccaaaagacgctagtaccaaagtgtttcgctttaatgctgtttcaggcggt
gatgcattttatgcgattaaaacacctacaatgaccagctatacattagcagaatataaa
acggttaagcgtccatatttaattgaatatattgactcatttgcgacacctcaaggtgca
aaagatacaaaaatgccaagcatgaaaattactttgtcattttccaagagcaatacaacg
aaaacgacagtgacat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0007155       P:cell adhesion
GO:0030001       P:metal ion transport
GO:0046872       F:metal ion binding
dbj|BAF68578.1 Staphylococcus aureus subsp. aureus str. Newman     Zn-binding lipoprotein adcA-like protein
fig|426430.6.peg.2234 Staphylococcus aureus subsp. aureus str. Newman FIG   Candidate zinc-binding lipoprotein ZinT
gi|150375318 Staphylococcus aureus subsp. aureus str. Newman NCBI   Zn-binding lipoprotein adcA-like protein
gi|151222518 Staphylococcus aureus subsp. aureus str. Newman NCBI   Zn-binding lipoprotein adcA-like protein
img|640796737 Staphylococcus aureus aureus Newman IMG   Zn-binding lipoprotein adcA-like protein
kegg|sae:NWMN_2306 Staphylococcus aureus subsp. aureus Newman KEGG   Zn-binding lipoprotein AdcA-like protein
ref|YP_001333340.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   Zn-binding lipoprotein adcA-like protein
tr|A6QJP6 Staphylococcus aureus (strain Newman) TrEMBL   Zn-binding lipoprotein adcA-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search