The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2506: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
Translate Function Assignments



Context on contig NC_009641 from base 2527008 to 2538288 (11281 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2501 2529413 2527008 2406 -       3: 2 1 3   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65     1: 4   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2506 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK

MD5 = 86894e7e499b2f1119913e1e14116c5a


  DNA Sequence

>fig|426430.8.peg.2506 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
atgacgattaaagttgaagataataaaattattttttcaagaacgatagaagcaccgatt
gaaaaggtgtttgatgcctatacgacaaaagcattatttgaaaaatggtttcatccaaaa
gacgctagtaccaaagtgtttcgctttaatgctgtttcaggcggtgatgcattttatgcg
attaaaacacctacaatgaccagctatacattagcagaatataaaacggttaagcgtcca
tatttaattgaatatattgactcatttgcgacacctcaaggtgcaaaagatacaaaaatg
ccaagcatgaaaattactttgtcattttccaagagcaatacaacgaaaacgacagtgaca
tcaacatcggtatttccaacaaaagaagccgctcaacaagtcataaacatgggtgttgaa
caaggtatgaatcaaactttagatcaacttgatgctttattgaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2506 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
aaatgaaattacatttactaaagatggtaagaaacacactggtaaatatgaatacaatgg
taagaaaacattgaaatatcctaaaggtaaccgtggcgtgagatttatgtttaaattggt
cgatggtaatgataaagacttaccgaaattcatccaatttagcgatcaccacattgcacc
taaaaaggcagaacacttccatatctttatgggtaatgataatgacgcgttattaaaaag
aatggattactggccaacatattatccttcaaaattaaataaagacccaatcaaagaaga
aatgttagcgcattatttcaacaggtttgcacactctactcaactgttaatagctgaata
gagtgtgttttttatttcgtagttatcaatttcaacagagggaatgattaatattactat
agtttatacaaatgatttggtaacatatgttactcaatgcatgttaagatgagtaaatat
aaaagatagggagtgggaagatgacgattaaagttgaagataataaaattattttttcaa
gaacgatagaagcaccgattgaaaaggtgtttgatgcctatacgacaaaagcattatttg
aaaaatggtttcatccaaaagacgctagtaccaaagtgtttcgctttaatgctgtttcag
gcggtgatgcattttatgcgattaaaacacctacaatgaccagctatacattagcagaat
ataaaacggttaagcgtccatatttaattgaatatattgactcatttgcgacacctcaag
gtgcaaaagatacaaaaatgccaagcatgaaaattactttgtcattttccaagagcaata
caacgaaaacgacagtgacatcaacatcggtatttccaacaaaagaagccgctcaacaag
tcataaacatgggtgttgaacaaggtatgaatcaaactttagatcaacttgatgctttat
tgaaataaagttgttgaaaatatgtaaaaacttttttgtttcattcggtttataataatc
ttgtaatattataaaaatgagggatgattcgatggtagaacgttatatcaaagttttaat
attatatattttcacaacactactatcttctatttcagtaacgtcaaaatgtgtacctaa
taaagttataaggtttattttacgtactgcaattggttacagtgtatttgcatatggttt
acattacttttcaaatttaaaaaagaataagtaatactttacataaagcgagataaaatg
agcgtcgtaatatcttaaatcataaagatattagccaatcacgcgatttatctcgctgtt
tttatgaaagaaaactacattttcgagagaataaaaagatttttctgaaatttaatctat
caattacattgatttactaatataattagaaagtaaattttatttgatcaaagtaaatgg
gggaagtactgtgatagaaaataagaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006950       P:response to stress
cmr|NT03SA2506 Staphylococcus aureus MW2     unknown conserved protein in others, putative
cmr|NT05SA2425 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA2307 Staphylococcus aureus subsp. aureus MSSA476     Aha1 domain superfamily, putative
cmr|SACOL2402 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2350 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB96192.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF68577.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG44109.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|196620.1.peg.2327 Staphylococcus aureus subsp. aureus MW2 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|196620.5.peg.2404 Staphylococcus aureus subsp. aureus MW2 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|282459.1.peg.2274 Staphylococcus aureus subsp. aureus MSSA476 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|282459.5.peg.2388 Staphylococcus aureus subsp. aureus MSSA476 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|367830.3.peg.436 Staphylococcus aureus subsp. aureus USA300 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|426430.6.peg.2233 Staphylococcus aureus subsp. aureus str. Newman FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|450394.6.peg.2189 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|451515.3.peg.2508 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|451516.9.peg.2497 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|452948.4.peg.549 Staphylococcus aureus 930918-3 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|455227.3.peg.805 Staphylococcus aureus D30 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|546342.3.peg.1511 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|546343.3.peg.1347 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|548474.3.peg.473 Staphylococcus aureus subsp. aureus TCH130 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|548475.3.peg.1762 Staphylococcus aureus subsp. aureus TCH70 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553567.3.peg.776 Staphylococcus aureus A5948 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553590.4.peg.1011 Staphylococcus aureus A9754 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|553594.3.peg.362 Staphylococcus aureus A9765 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|644279.4.peg.2548 Staphylococcus aureus subsp. aureus 132 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|762962.3.peg.2103 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93061.3.peg.2543 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93061.5.peg.2436 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93062.19.peg.2346 Staphylococcus aureus subsp. aureus COL FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
fig|93062.4.peg.2460 Staphylococcus aureus subsp. aureus COL FIG   Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)
gb|AAW37227.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21146.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31697.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EES55999.1 Staphylococcus aureus subsp. aureus TCH70     activator of Hsp90 ATPase 1 family protein
gb|EES94894.1 Staphylococcus aureus subsp. aureus USA300_TCH959     activator of Hsp90 ATPase 1 family protein
gb|EES96603.1 Staphylococcus aureus subsp. aureus TCH130     activator of Hsp90 ATPase 1 family protein
gb|EEV83897.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45566.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1327
gb|EEW47633.1 Staphylococcus aureus D30     hypothetical protein SAD30_0661
gi|150375317 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222517 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2305
gi|21205499 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21284056 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2327
gi|221138488 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_07558
gi|221141317 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06703
gi|251803342 Staphylococcus aureus subsp. aureus TCH70 NCBI   activator of Hsp90 ATPase 1 family protein
gi|251813159 Staphylococcus aureus subsp. aureus TCH70 NCBI   activator of Hsp90 ATPase 1 family protein
gi|253726165 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   activator of Hsp90 ATPase 1 family protein
gi|253727874 Staphylococcus aureus subsp. aureus TCH130 NCBI   activator of Hsp90 ATPase 1 family protein
gi|253730078 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   activator of Hsp90 ATPase 1 family protein
gi|253734179 Staphylococcus aureus subsp. aureus TCH130 NCBI   activator of Hsp90 ATPase 1 family protein
gi|257861082 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451290 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160543 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1327
gi|259163072 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0661
gi|49245630 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49487187 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2296
gi|57285133 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650947 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2402
gi|87126632 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160658 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2350
gi|87203887 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196329 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02689
img|637153158 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637158565 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300144 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888993 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895300 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796736 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641773050 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2350 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2402 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2305 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW2327 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02689 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2296   KEGG   hypothetical protein
ref|NP_647144.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2327
ref|YP_001333339.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2305
ref|YP_044408.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2296
ref|YP_187205.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2402
ref|YP_494985.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2350
ref|YP_501151.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02689
ref|ZP_03563290.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_07558
ref|ZP_03565810.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06703
ref|ZP_04827632.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   activator of Hsp90 ATPase 1 family protein
ref|ZP_04864243.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   activator of Hsp90 ATPase 1 family protein
ref|ZP_04868344.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   activator of Hsp90 ATPase 1 family protein
ref|ZP_05699323.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJP5 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|C5MZV1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Activator of Hsp90 ATPase 1 family protein
tr|C5Q2H5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Activator of Hsp90 ATPase 1 family protein
tr|C5QFR6 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Activator of Hsp90 ATPase 1 family protein
tr|Q2FE93 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1U9 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDF2 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G6R6 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NV17 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2327


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search