The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2505: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01107855: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 2527008 to 2538288 (11281 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2501 2529413 2527008 2406 -       3: 2 1 3   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65     1: 4   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2505 FIG01107855: hypothetical protein
MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSVFAYGLHYFSNLKKNK

MD5 = a4988c2324a81b4c01420bd1a38a99a2


  DNA Sequence

>fig|426430.8.peg.2505 FIG01107855: hypothetical protein
atggtagaacgttatatcaaagttttaatattatatattttcacaacactactatcttct
atttcagtaacgtcaaaatgtgtacctaataaagttataaggtttattttacgtactgca
attggttacagtgtatttgcatatggtttacattacttttcaaatttaaaaaagaataag
taa


  DNA with Flanking Sequence

>fig|426430.8.peg.2505 FIG01107855: hypothetical protein
gcaccgattgaaaaggtgtttgatgcctatacgacaaaagcattatttgaaaaatggttt
catccaaaagacgctagtaccaaagtgtttcgctttaatgctgtttcaggcggtgatgca
ttttatgcgattaaaacacctacaatgaccagctatacattagcagaatataaaacggtt
aagcgtccatatttaattgaatatattgactcatttgcgacacctcaaggtgcaaaagat
acaaaaatgccaagcatgaaaattactttgtcattttccaagagcaatacaacgaaaacg
acagtgacatcaacatcggtatttccaacaaaagaagccgctcaacaagtcataaacatg
ggtgttgaacaaggtatgaatcaaactttagatcaacttgatgctttattgaaataaagt
tgttgaaaatatgtaaaaacttttttgtttcattcggtttataataatcttgtaatatta
taaaaatgagggatgattcgatggtagaacgttatatcaaagttttaatattatatattt
tcacaacactactatcttctatttcagtaacgtcaaaatgtgtacctaataaagttataa
ggtttattttacgtactgcaattggttacagtgtatttgcatatggtttacattactttt
caaatttaaaaaagaataagtaatactttacataaagcgagataaaatgagcgtcgtaat
atcttaaatcataaagatattagccaatcacgcgatttatctcgctgtttttatgaaaga
aaactacattttcgagagaataaaaagatttttctgaaatttaatctatcaattacattg
atttactaatataattagaaagtaaattttatttgatcaaagtaaatgggggaagtactg
tgatagaaaataagaaaacagttgaagatacatattcaacaggcgcaattgttgattcaa
tatcatcttcagtacaaatgaagcaagtaatggtacagcaaacacctggccgatatatgc
ttaaagcaatgatggccggatttttactctcaatcgttactgtatttatgttcggaataa
agacgcagtttgcgagtactcacgtagatggacttatcaatttaatgggagccattgcgt
ttagtttaggtttgattttagttgtattaactaactctgaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA2505 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA2424 Staphylococcus aureus NCTC 8325     conserved domain protein
dbj|BAB96191.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF68576.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG44108.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|196620.1.peg.2326 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107855: hypothetical protein
fig|196620.5.peg.2403 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107855: hypothetical protein
fig|282459.1.peg.2273 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107855: hypothetical protein
fig|282459.5.peg.2387 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107855: hypothetical protein
fig|451515.3.peg.2507 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107855: hypothetical protein
fig|451516.9.peg.2496 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107855: hypothetical protein
fig|452948.4.peg.550 Staphylococcus aureus 930918-3 FIG   FIG01107855: hypothetical protein
fig|455227.3.peg.806 Staphylococcus aureus D30 FIG   FIG01107855: hypothetical protein
fig|546342.3.peg.1510 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107855: hypothetical protein
fig|546343.3.peg.1348 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107855: hypothetical protein
fig|548475.3.peg.1763 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01107855: hypothetical protein
fig|553567.3.peg.777 Staphylococcus aureus A5948 FIG   FIG01107855: hypothetical protein
fig|553590.4.peg.1010 Staphylococcus aureus A9754 FIG   FIG01107855: hypothetical protein
fig|553594.3.peg.361 Staphylococcus aureus A9765 FIG   FIG01107855: hypothetical protein
fig|644279.4.peg.2547 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107855: hypothetical protein
fig|762962.3.peg.2104 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01107855: hypothetical protein
fig|93061.3.peg.2542 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107855: hypothetical protein
fig|93061.5.peg.2435 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107855: hypothetical protein
gb|ABD31696.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EES56000.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV83898.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45565.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1326
gb|EEW47632.1 Staphylococcus aureus D30     hypothetical protein SAD30_0660
gi|150375316 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222516 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2304
gi|21205498 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21284055 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2326
gi|221138487 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_07553
gi|221141318 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06708
gi|251803343 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813160 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|257861083 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451291 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160542 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1326
gi|259163071 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0660
gi|49245629 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49487186 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2295
gi|87203886 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196328 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02688
img|637158564 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300143 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637895299 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796735 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641773051 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|sae:NWMN_2304 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW2326 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02688 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2295   KEGG   hypothetical protein
ref|NP_647143.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2326
ref|YP_001333338.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2304
ref|YP_044407.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2295
ref|YP_501150.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02688
ref|ZP_03563289.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_07553
ref|ZP_03565811.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06708
ref|ZP_04827633.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_05699324.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJP4 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|C5QFR7 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2G1U7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q6G6R7 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q8NV18 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2326


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search