The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2504: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: formate/nitrite transporter family protein
Translate Function Assignments



Context on contig NC_009641 from base 2525722 to 2536783 (11062 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2499 2526699 2525722 978 -   4 4: 4 5 7 6   Uroporphyrinogen-III methyltransferase (EC 2.1.1.107) gene_name|cysG, locus|NWMN_2298, protein_id|YP_001333332.1, gi|151222510, geneID|5332196
2500 2527004 2526690 315 - -10     3: 2 1 3   Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) gene_name|nirD, locus|NWMN_2299, protein_id|YP_001333333.1, gi|151222511, geneID|5331849
2501 2529413 2527008 2406 - 3 4 3: 2 1 3   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65     1: 4   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232       formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18 5     FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2504 formate/nitrite transporter family protein
MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
KTQFASTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ

MD5 = 52d830163c59513e46311b5534fe779d


  DNA Sequence

>fig|426430.8.peg.2504 formate/nitrite transporter family protein
gtgatagaaaataagaaaacagttgaagatacatattcaacaggcgcaattgttgattca
atatcatcttcagtacaaatgaagcaagtaatggtacagcaaacacctggccgatatatg
cttaaagcaatgatggccggatttttactctcaatcgttactgtatttatgttcggaata
aagacgcagtttgcgagtactcacgtagatggacttatcaatttaatgggagccattgcg
tttagtttaggtttgattttagttgtattaactaactctgaattattaacaagtaacttc
atgtactttacagtaggctggtattataaagtcgtttctgttaagaagatgacttggatt
ttattatattgtttcttaggaaatattttaggtgggtttgtgttatttttcttaatgaaa
tttgcgcatgtcatgacacctgaaatgacacaagctttaacagctttagttcagaaaaag
actgttgattcaacatggttgaatatttttacaaaaggtattttctgtaacttctttatt
aatattggtattttcatctctatgcaattcaaaggcggcttaacaaaggcattcttcata
gcttgtggtgtcgtggtctttgtatacatgggatatgagcacgttgtgttcaatgcaggt
ctatatgcaggtatggtattctttaaccttgatgcagtttcatggttacacgttttaaaa
aatatcgtttttgctttcttaggtaactttgtcggtggcggtatttttgtaggtctcgtt
tatgctttcttaaatggtaagcgtaatcgtttagagcaacaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2504 formate/nitrite transporter family protein
gatgctttattgaaataaagttgttgaaaatatgtaaaaacttttttgtttcattcggtt
tataataatcttgtaatattataaaaatgagggatgattcgatggtagaacgttatatca
aagttttaatattatatattttcacaacactactatcttctatttcagtaacgtcaaaat
gtgtacctaataaagttataaggtttattttacgtactgcaattggttacagtgtatttg
catatggtttacattacttttcaaatttaaaaaagaataagtaatactttacataaagcg
agataaaatgagcgtcgtaatatcttaaatcataaagatattagccaatcacgcgattta
tctcgctgtttttatgaaagaaaactacattttcgagagaataaaaagatttttctgaaa
tttaatctatcaattacattgatttactaatataattagaaagtaaattttatttgatca
aagtaaatgggggaagtactgtgatagaaaataagaaaacagttgaagatacatattcaa
caggcgcaattgttgattcaatatcatcttcagtacaaatgaagcaagtaatggtacagc
aaacacctggccgatatatgcttaaagcaatgatggccggatttttactctcaatcgtta
ctgtatttatgttcggaataaagacgcagtttgcgagtactcacgtagatggacttatca
atttaatgggagccattgcgtttagtttaggtttgattttagttgtattaactaactctg
aattattaacaagtaacttcatgtactttacagtaggctggtattataaagtcgtttctg
ttaagaagatgacttggattttattatattgtttcttaggaaatattttaggtgggtttg
tgttatttttcttaatgaaatttgcgcatgtcatgacacctgaaatgacacaagctttaa
cagctttagttcagaaaaagactgttgattcaacatggttgaatatttttacaaaaggta
ttttctgtaacttctttattaatattggtattttcatctctatgcaattcaaaggcggct
taacaaaggcattcttcatagcttgtggtgtcgtggtctttgtatacatgggatatgagc
acgttgtgttcaatgcaggtctatatgcaggtatggtattctttaaccttgatgcagttt
catggttacacgttttaaaaaatatcgtttttgctttcttaggtaactttgtcggtggcg
gtatttttgtaggtctcgtttatgctttcttaaatggtaagcgtaatcgtttagagcaac
aataattaagatgtagtgattaaatagcgtaacaatgaatcattcttccaaaccattcat
gaatttgaatggttttttacgttgagagagtaatttttaataagtttcatgagagtattg
gtgtattcagatgaagcatactttctgacatgtgataaatttattgatacactttgatgg
atatttattttaaaaataaaatatggttaaatcatttaaaaaagagtggggattaatatg
acaaaaacgatgattcgactcgcaagtgaacaagatgcagaaaaattgcaacaactcatg
catgaagcatttacgcctctaagagaactaggtattgattggccttcggttaatgctaat
ttagatgctgttaaagaaaatatagataaaaatactacatttgtcatgacaattgatgat
gaaattatatctacgattacggttagatatccttggggaagtgtgaaaagtatttcgggt
tatccttttgtctggtggtttgcga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005215       F:transporter activity
GO:0006810       P:transport
GO:0016020       C:membrane
cmr|NT03SA2504 Staphylococcus aureus MW2     formate/nitrite transporter
cmr|NT05SA2423 Staphylococcus aureus NCTC 8325     formate/nitrite transporter
cmr|NT09SA2306 Staphylococcus aureus subsp. aureus MSSA476     formate/nitrite transporter family protein
cmr|SACOL2401 Staphylococcus aureus subsp. aureus COL     formate/nitrite transporter family protein
cmr|SAUSA300_2349 Staphylococcus aureus subsp. aureus USA300-FPR3757     formate/nitrite transporter family protein
dbj|BAB96190.1 Staphylococcus aureus subsp. aureus MW2     MW2325
dbj|BAF68575.1 Staphylococcus aureus subsp. aureus str. Newman     formate/nitrite transporter family protein
emb|CAG44107.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative nitrite transporter
fig|196620.1.peg.2325 Staphylococcus aureus subsp. aureus MW2 FIG   formate/nitrite transporter family protein
fig|196620.5.peg.2402 Staphylococcus aureus subsp. aureus MW2 FIG   formate/nitrite transporter family protein
fig|282459.1.peg.2272 Staphylococcus aureus subsp. aureus MSSA476 FIG   formate/nitrite transporter family protein
fig|282459.5.peg.2386 Staphylococcus aureus subsp. aureus MSSA476 FIG   formate/nitrite transporter family protein
fig|367830.3.peg.435 Staphylococcus aureus subsp. aureus USA300 FIG   formate/nitrite transporter family protein
fig|426430.6.peg.2232 Staphylococcus aureus subsp. aureus str. Newman FIG   formate/nitrite transporter family protein
fig|451515.3.peg.2506 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   formate/nitrite transporter family protein
fig|451516.9.peg.2495 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   formate/nitrite transporter family protein
fig|452948.4.peg.551 Staphylococcus aureus 930918-3 FIG   formate/nitrite transporter family protein
fig|455227.3.peg.807 Staphylococcus aureus D30 FIG   formate/nitrite transporter family protein
fig|546342.3.peg.1509 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   formate/nitrite transporter family protein
fig|546343.3.peg.1349 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   formate/nitrite transporter family protein
fig|548474.3.peg.475 Staphylococcus aureus subsp. aureus TCH130 FIG   formate/nitrite transporter family protein
fig|548475.3.peg.1764 Staphylococcus aureus subsp. aureus TCH70 FIG   formate/nitrite transporter family protein
fig|553567.3.peg.778 Staphylococcus aureus A5948 FIG   formate/nitrite transporter family protein
fig|553590.4.peg.1009 Staphylococcus aureus A9754 FIG   formate/nitrite transporter family protein
fig|553594.3.peg.360 Staphylococcus aureus A9765 FIG   formate/nitrite transporter family protein
fig|644279.4.peg.2546 Staphylococcus aureus subsp. aureus 132 FIG   formate/nitrite transporter family protein
fig|762962.3.peg.2105 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   formate/nitrite transporter family protein
fig|93061.3.peg.2541 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   formate/nitrite transporter family protein
fig|93061.5.peg.2434 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   formate/nitrite transporter family protein
fig|93062.19.peg.2344 Staphylococcus aureus subsp. aureus COL FIG   formate/nitrite transporter family protein
fig|93062.4.peg.2459 Staphylococcus aureus subsp. aureus COL FIG   formate/nitrite transporter family protein
gb|AAW37226.1 Staphylococcus aureus subsp. aureus COL     formate/nitrite transporter family protein
gb|ABD21825.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     formate/nitrite transporter family protein
gb|ABD31695.1 Staphylococcus aureus subsp. aureus NCTC 8325     formate/nitrite transporter, putative
gb|EEV83899.1 Staphylococcus aureus A5948     formate/nitrite transporter
gb|EEW45564.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1325
gb|EEW47631.1 Staphylococcus aureus D30     hypothetical protein SAD30_0659
gi|150375315 Staphylococcus aureus subsp. aureus str. Newman NCBI   formate/nitrite transporter family protein
gi|151222515 Staphylococcus aureus subsp. aureus str. Newman NCBI   formate/nitrite transporter family protein
gi|21205497 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2325
gi|21284054 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2325
gi|221138486 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   formate/nitrite transporter family protein
gi|221141319 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   formate/nitrite transporter family protein
gi|257861084 Staphylococcus aureus A5948 NCBI   formate/nitrite transporter
gi|258451292 Staphylococcus aureus A5948 NCBI   formate/nitrite transporter
gi|259160541 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1325
gi|259163070 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0659
gi|49245628 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative nitrite transporter
gi|49487185 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative nitrite transporter
gi|57285132 Staphylococcus aureus subsp. aureus COL NCBI   formate/nitrite transporter family protein
gi|57650946 Staphylococcus aureus subsp. aureus COL NCBI   formate/nitrite transporter family protein
gi|87127311 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   formate/nitrite transporter family protein
gi|87161337 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   formate/nitrite transporter family protein
gi|87203885 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   formate/nitrite transporter, putative
gi|88196327 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   formate/nitrite transporter, putative
img|637153157 Staphylococcus aureus aureus COL IMG   formate/nitrite transporter family protein
img|637158563 Staphylococcus aureus aureus MSSA476 IMG   putative nitrite transporter
img|637300142 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888992 Staphylococcus aureus aureus USA300 IMG   formate/nitrite transporter family protein
img|637895298 Staphylococcus aureus aureus NCTC 8325 IMG   formate/nitrite transporter, putative
img|640796734 Staphylococcus aureus aureus Newman IMG   formate/nitrite transporter family protein
img|641773052 Staphylococcus aureus aureus USA300_TCH959 IMG   formate/nitrite transporter family protein
kegg|saa:SAUSA300_2349 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   formate/nitrite transporter family protein
kegg|sac:SACOL2401 Staphylococcus aureus subsp. aureus COL KEGG   formate/nitrite transporter family protein
kegg|sae:NWMN_2303 Staphylococcus aureus subsp. aureus Newman KEGG   formate/nitrite transporter family protein
kegg|sam:MW2325 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02687 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   formate/nitrite transporter, putative
kegg|sas:SAS2294   KEGG   putative nitrite transporter
ref|NP_647142.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2325
ref|YP_001333337.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   formate/nitrite transporter family protein
ref|YP_044406.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative nitrite transporter
ref|YP_187204.1 Staphylococcus aureus subsp. aureus COL RefSeq   formate/nitrite transporter family protein
ref|YP_494984.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   formate/nitrite transporter family protein
ref|YP_501149.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   formate/nitrite transporter, putative
ref|ZP_03563288.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   formate/nitrite transporter family protein
ref|ZP_03565812.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   formate/nitrite transporter family protein
ref|ZP_05699325.1 Staphylococcus aureus A5948 RefSeq   formate/nitrite transporter
tr|A6QJP3 Staphylococcus aureus (strain Newman) TrEMBL   Formate/nitrite transporter family protein
tr|Q2FE94 Staphylococcus aureus (strain USA300) TrEMBL   Formate/nitrite transporter family protein
tr|Q2G1V0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Formate/nitrite transporter, putative
tr|Q5HDF3 Staphylococcus aureus (strain COL) TrEMBL   Formate/nitrite transporter family protein
tr|Q6G6R8 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative nitrite transporter
tr|Q8NV19 Staphylococcus aureus (strain MW2) TrEMBL   MW2325 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.2499 Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)
4 fig|426430.8.peg.2501 Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4)
5 fig|426430.8.peg.2511 FIG01108076: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search